CK932589

Overview
NameCK932589
Unique NameCK932589
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length616
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1793 contig Csv1_Contig1793:145..760. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK932589 vs. ExPASy Swiss-Prot
Match: GLRX_SOLLC (Glutaredoxin OS=Solanum lycopersicum PE=3 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 1.111e-42
Identity = 80/106 (75.47%), Postives = 95/106 (89.62%), Query Frame = 2
Query:   92 MALPKAQETVSSNSVVVFSKTFCPFCVSVKELFQQLGVTFKAIELNKESDGSDIQSALAEWTGQKTVPNVFIGGKHVGGCDSTTALHREGKLVPLLTEAGAVAKTA 409
            M+L KA+E VS N V VFSKT+CPFCVSVK+L  +LG TFKA+EL+ E DGS+IQ+ALAEWTGQ+TVPNVFIG KH+GGCD+TTALHREGKL+PLLTEAGA+AKT+
Sbjct:    1 MSLAKAKEIVSGNPVAVFSKTYCPFCVSVKDLLSKLGATFKAVELDSEKDGSEIQAALAEWTGQRTVPNVFIGRKHIGGCDATTALHREGKLLPLLTEAGAIAKTS 106          
BLAST of CK932589 vs. ExPASy Swiss-Prot
Match: GLRX_VERFO (Glutaredoxin OS=Vernicia fordii PE=3 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 1.895e-42
Identity = 80/102 (78.43%), Postives = 91/102 (89.22%), Query Frame = 2
Query:   92 MALPKAQETVSSNSVVVFSKTFCPFCVSVKELFQQLGVTFKAIELNKESDGSDIQSALAEWTGQKTVPNVFIGGKHVGGCDSTTALHREGKLVPLLTEAGAV 397
            MA+ KAQE VSSNSVVVFSKTFCP+C SVK+L  QLG  FK IEL+ ESDGSD+Q+ALAEWTGQ+TVPNVFIGGKH+GGCD TT +H+EGKL+PLLTEAGAV
Sbjct:    1 MAMIKAQELVSSNSVVVFSKTFCPYCTSVKQLLNQLGAQFKVIELDSESDGSDLQNALAEWTGQRTVPNVFIGGKHIGGCDKTTGMHQEGKLIPLLTEAGAV 102          
BLAST of CK932589 vs. ExPASy Swiss-Prot
Match: GRXC6_ORYSJ (Glutaredoxin-C6 OS=Oryza sativa subsp. japonica GN=GRXC6 PE=1 SV=2)

HSP 1 Score: 168.703 bits (426), Expect = 2.095e-41
Identity = 80/106 (75.47%), Postives = 95/106 (89.62%), Query Frame = 2
Query:   92 MALPKAQETVSSNSVVVFSKTFCPFCVSVKELFQQLGVTFKAIELNKESDGSDIQSALAEWTGQKTVPNVFIGGKHVGGCDSTTALHREGKLVPLLTEAGAVAKTA 409
            MAL KA+ETV+S  VVV+SK++CPFCV VK+LF+QLG TFKAIEL+ ESDGS++QSALAEWTGQ+TVPNVFI GKH+GGCD T AL+ EGKLVPLLTEAGA+A +A
Sbjct:    1 MALAKAKETVASAPVVVYSKSYCPFCVRVKKLFEQLGATFKAIELDGESDGSELQSALAEWTGQRTVPNVFINGKHIGGCDDTLALNNEGKLVPLLTEAGAIASSA 106          
BLAST of CK932589 vs. ExPASy Swiss-Prot
Match: GRXC2_ARATH (Glutaredoxin-C2 OS=Arabidopsis thaliana GN=GRXC2 PE=2 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 7.961e-41
Identity = 80/107 (74.77%), Postives = 94/107 (87.85%), Query Frame = 2
Query:   92 MALPKAQETVSSNSVVVFSKTFCPFCVSVKELFQQLGVTFKAIELNKESDGSDIQSALAEWTGQKTVPNVFIGGKHVGGCDSTTALHREGKLVPLLTEAGAVA-KTA 409
            MA+ KA+E V+S SVVVFSKT+CP+CV VKEL QQLG  FKA+EL+ ESDGS IQS LAEWTGQ+TVPNVFIGG H+GGCD+T+ LH++GKLVPLLTEAGA+A KTA
Sbjct:    1 MAMQKAKEIVNSESVVVFSKTYCPYCVRVKELLQQLGAKFKAVELDTESDGSQIQSGLAEWTGQRTVPNVFIGGNHIGGCDATSNLHKDGKLVPLLTEAGAIAGKTA 107          
BLAST of CK932589 vs. ExPASy Swiss-Prot
Match: GLRX_RICCO (Glutaredoxin OS=Ricinus communis PE=3 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.150e-39
Identity = 75/102 (73.53%), Postives = 90/102 (88.24%), Query Frame = 2
Query:   92 MALPKAQETVSSNSVVVFSKTFCPFCVSVKELFQQLGVTFKAIELNKESDGSDIQSALAEWTGQKTVPNVFIGGKHVGGCDSTTALHREGKLVPLLTEAGAV 397
            MA+ K +E VSSN+VVVFSKT+CP+C SVK+L  QLG  +K +EL+ ESDGS+IQ+ALAEWTGQ+TVPNVFIGGKH+GGCDSTTA H +G+LVPLLTEAGAV
Sbjct:    1 MAMTKTKELVSSNAVVVFSKTYCPYCTSVKKLLDQLGAKYKVVELDTESDGSEIQTALAEWTGQRTVPNVFIGGKHIGGCDSTTAKHSQGQLVPLLTEAGAV 102          
BLAST of CK932589 vs. ExPASy Swiss-Prot
Match: GRXC4_ORYSJ (Glutaredoxin-C4, chloroplastic OS=Oryza sativa subsp. japonica GN=GRXC4 PE=3 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.315e-35
Identity = 69/112 (61.61%), Postives = 90/112 (80.36%), Query Frame = 2
Query:   65 RIKDKEDTEMALPKAQETVSSNSVVVFSKTFCPFCVSVKELFQQLGVTFKAIELNKESDGSDIQSALAEWTGQKTVPNVFIGGKHVGGCDSTTALHREGKLVPLLTEAGAVA 400
            ++++     MAL KA+E V+S+ VVVFSKT+CPFC  VK L  +L  ++KA+EL+ ESDGS++QSALA+WTGQ+TVP VFI GKH+GGCD T A+H+ G LVPLLTEAGA+A
Sbjct:   18 QLEEPSKPVMALDKAKEIVASSPVVVFSKTYCPFCARVKRLLAELAASYKAVELDVESDGSELQSALADWTGQRTVPCVFIKGKHIGGCDDTMAMHKGGNLVPLLTEAGAIA 129          
BLAST of CK932589 vs. ExPASy Swiss-Prot
Match: GRXC1_ARATH (Glutaredoxin-C1 OS=Arabidopsis thaliana GN=GRXC1 PE=2 SV=2)

HSP 1 Score: 142.895 bits (359), Expect = 1.231e-33
Identity = 67/112 (59.82%), Postives = 87/112 (77.68%), Query Frame = 2
Query:   77 KEDTEMALPKAQETVSSNSVVVFSKTFCPFCVSVKELFQQLGVTFKAIELNKESDGSDIQSALAEWTGQKTVPNVFIGGKHVGGCDSTTALHREGKLVPLLTEAGAVAKTAA 412
            KE+ E+ + KA+E VS+  VVVFSKT+C +C  VK+L  QLG TFK +EL++ SDG +IQSAL+EWTGQ TVPNVFI G H+GGCD     +++GKLVPLLTEAGA+A  ++
Sbjct:   12 KEEMEVVVNKAKEIVSAYPVVVFSKTYCGYCQRVKQLLTQLGATFKVLELDEMSDGGEIQSALSEWTGQTTVPNVFIKGNHIGGCDRVMETNKQGKLVPLLTEAGAIADNSS 123          
BLAST of CK932589 vs. ExPASy Swiss-Prot
Match: GLRX_DICDI (Glutaredoxin OS=Dictyostelium discoideum GN=grxA PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 1.045e-24
Identity = 50/98 (51.02%), Postives = 74/98 (75.51%), Query Frame = 2
Query:   98 LPKAQETVSSNSVVVFSKTFCPFCVSVKELFQQLGVTFKAIELNKESDGSDIQSALAEWTGQKTVPNVFIGGKHVGGCDSTTALHREGKLVPLLTEAG 391
            + K +  + ++ +++FSKT CP+C+SVK+LF++L V    +EL+ ESDGS++QSA  + +G +TVP VFI  K +GGCD+TT LH +GKL+PLL EAG
Sbjct:    1 MDKVKALIKAHKLIIFSKTTCPYCISVKDLFKKLKVVPFVVELDLESDGSELQSAAGQISGVRTVPQVFINEKFIGGCDATTKLHSQGKLIPLLQEAG 98          
BLAST of CK932589 vs. ExPASy Swiss-Prot
Match: GLRX2_MOUSE (Glutaredoxin-2, mitochondrial OS=Mus musculus GN=Glrx2 PE=1 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 2.663e-20
Identity = 43/100 (43.00%), Postives = 67/100 (67.00%), Query Frame = 2
Query:   80 EDTEMALPKAQETVSSNSVVVFSKTFCPFCVSVKELFQQLGVTFKAIELNKESDGSDIQSALAEWTGQKTVPNVFIGGKHVGGCDSTTALHREGKLVPLL 379
            + T   + + QET+S+N VV+FSKT C +C   K++F  + V +KA+EL+    G+  Q AL + TG++TVP +F+ G+ +GG   T  LH+EGKL+PL+
Sbjct:   44 KSTTTPVNQIQETISNNCVVIFSKTSCSYCSMAKKIFHDMNVNYKAVELDMLEYGNQFQDALHKMTGERTVPRIFVNGRFIGGAADTHRLHKEGKLLPLV 143          
BLAST of CK932589 vs. ExPASy Swiss-Prot
Match: GLRX2_BOVIN (Glutaredoxin-2, mitochondrial OS=Bos taurus GN=GLRX2 PE=2 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 4.542e-20
Identity = 43/90 (47.78%), Postives = 60/90 (66.67%), Query Frame = 2
Query:  110 QETVSSNSVVVFSKTFCPFCVSVKELFQQLGVTFKAIELNKESDGSDIQSALAEWTGQKTVPNVFIGGKHVGGCDSTTALHREGKLVPLL 379
            QET+S+N VV+FSKT C +C   K LF  + V +K +EL+    GS  Q AL + TG++TVP +F+ G  +GG   T  LH+EGKL+PL+
Sbjct:   55 QETISNNCVVIFSKTSCSYCTMAKNLFHDMNVNYKVVELDMLEYGSQFQDALHKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLV 144          
The following BLAST results are available for this feature:
BLAST of CK932589 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 48
Match NameE-valueIdentityDescription
GLRX_SOLLC1.111e-4275.47Glutaredoxin OS=Solanum lycopersicum PE=3 SV=1[more]
GLRX_VERFO1.895e-4278.43Glutaredoxin OS=Vernicia fordii PE=3 SV=1[more]
GRXC6_ORYSJ2.095e-4175.47Glutaredoxin-C6 OS=Oryza sativa subsp. japonica GN... [more]
GRXC2_ARATH7.961e-4174.77Glutaredoxin-C2 OS=Arabidopsis thaliana GN=GRXC2 P... [more]
GLRX_RICCO1.150e-3973.53Glutaredoxin OS=Ricinus communis PE=3 SV=1[more]
GRXC4_ORYSJ1.315e-3561.61Glutaredoxin-C4, chloroplastic OS=Oryza sativa sub... [more]
GRXC1_ARATH1.231e-3359.82Glutaredoxin-C1 OS=Arabidopsis thaliana GN=GRXC1 P... [more]
GLRX_DICDI1.045e-2451.02Glutaredoxin OS=Dictyostelium discoideum GN=grxA P... [more]
GLRX2_MOUSE2.663e-2043.00Glutaredoxin-2, mitochondrial OS=Mus musculus GN=G... [more]
GLRX2_BOVIN4.542e-2047.78Glutaredoxin-2, mitochondrial OS=Bos taurus GN=GLR... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit juice sac at 38 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004531_H12 Developing fruit juice sac at 38 DAFB Citrus sinensis cDNA clone JSJune0002_IIIF_H12 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK932589 ID=CK932589|Name=CK932589|organism=Citrus sinensis|type=EST|length=616bp
GGGGAAGTTCTCTCCTTTGTAAAGCCAAAGAGGATTTGAAGCTTATTTAG
GGTTTGTGAGATTTCGAATCAAAGACAAAGAAGACACAGAAATGGCTTTG
CCCAAGGCCCAGGAAACCGTTTCCTCCAATTCCGTCGTCGTTTTCAGCAA
AACGTTTTGTCCGTTCTGCGTGAGTGTCAAAGAGCTGTTTCAGCAACTCG
GAGTCACTTTCAAGGCCATTGAACTGAACAAAGAAAGTGATGGAAGTGAC
ATTCAATCAGCTCTAGCTGAGTGGACTGGACAGAAAACTGTTCCAAATGT
CTTCATCGGAGGGAAACACGTTGGTGGCTGCGATTCAACTACTGCACTGC
ACAGGGAAGGGAAGCTGGTTCCTCTGCTCACTGAAGCTGGAGCTGTTGCC
AAGACAGCTGCCTGATGGATGGCTATTGTCTGCCTGTTAATTCTAGTAAT
AAATAAAGAATGTGTTGGTAGTGCTTAATCTGTCTGAATTAAACATGAAA
TTATGCTTATTTGAGTAATTTCCAATGCACTTTTTTGTTCAGTTTCTGTT
TTATGTTGAAATCTGTATGAATTTTATCAGATTTTTCAAAAAAAAAAAAA
AAAAAAAAAAAAAAAA
back to top