CK932608

Overview
NameCK932608
Unique NameCK932608
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length778
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4140 contig Csv1_Contig4140:229..1005. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK932608 vs. ExPASy Swiss-Prot
Match: YPTV3_VOLCA (GTP-binding protein yptV3 OS=Volvox carteri GN=YPTV3 PE=3 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 3.916e-39
Identity = 79/124 (63.71%), Postives = 96/124 (77.42%), Query Frame = 1
Query:    7 IWDTAGQERFRTLTSSYYRGAQGIIMVYDVTRRDTFTNLSDVWAKEIDLYSTNQDCIKLLVGNKVDKESERVVTKKEGINFAREYGCLFIECSAKTRVNVQQCFEELVLKILDTPSLLAEGSKG 378
            IWDTAGQERFRTLTSSYYRGAQGII VYDVTRRDTF +L   W +E D+YST +  IK++V NKVD  ++R V+ +EG +FAR +GCLF+E SA+  + V Q FEEL+LKILDTP LL   + G
Sbjct:   62 IWDTAGQERFRTLTSSYYRGAQGIIFVYDVTRRDTFESLEANWMREFDIYSTVESAIKMVVANKVDLSAQRQVSSEEGHDFARRHGCLFVETSARANLAVGQAFEELLLKILDTPLLLETTAVG 185          
BLAST of CK932608 vs. ExPASy Swiss-Prot
Match: RB18B_DANRE (Ras-related protein Rab-18-B OS=Danio rerio GN=rab18b PE=2 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 4.787e-37
Identity = 80/145 (55.17%), Postives = 98/145 (67.59%), Query Frame = 1
Query:    4 AIWDTAGQERFRTLTSSYYRGAQGIIMVYDVTRRDTFTNLSDVWAKEIDLYSTNQDCIKLLVGNKVDKESERVVTKKEGINFAREYGCLFIECSAKTRVNVQQCFEELVLKILDTPSLLAEGSKGLKKNIFKQKPPEADAAASGC 438
            AIWDTAGQERFRTLT SYYRGAQG+I+VYDVT+RDTFT L + W  E++ Y T  D +K+LVGNK+DK++ R V + EG+ FAR++  LFIE SAKTR  VQ  FEELV KIL TP L     +     +   +P    A    C
Sbjct:   60 AIWDTAGQERFRTLTPSYYRGAQGVILVYDVTKRDTFTKLEN-WLNELETYCTRNDLVKMLVGNKIDKDN-REVDRNEGLKFARKHSMLFIEASAKTRDGVQCAFEELVEKILQTPGLWESSIQNHGVQLSDNEPQRQGACGGYC 202          
BLAST of CK932608 vs. ExPASy Swiss-Prot
Match: RAB18_CHICK (Ras-related protein Rab-18 OS=Gallus gallus GN=RAB18 PE=2 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 6.252e-37
Identity = 81/146 (55.48%), Postives = 98/146 (67.12%), Query Frame = 1
Query:    4 AIWDTAGQERFRTLTSSYYRGAQGIIMVYDVTRRDTFTNLSDVWAKEIDLYSTNQDCIKLLVGNKVDKESERVVTKKEGINFAREYGCLFIECSAKTRVNVQQCFEELVLKILDTPSLLAEGSKGLKKNIFKQKPPEADAAASGCC 441
            AIWDTAGQERFRTLT SYYRGAQG+I+VYDVTRRDTF  L D W  E++ Y T  D +K+LVGNK+DKE+ R V + EG+ FAR++  LFIE SAKT   VQ  FEELV KI+ TP L    S+     +  ++      A  G C
Sbjct:   60 AIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKL-DNWLNELETYCTRNDIVKMLVGNKIDKEN-REVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESESQNKGVKLSNKEEGHGGGACGGYC 203          
BLAST of CK932608 vs. ExPASy Swiss-Prot
Match: RAB18_PONAB (Ras-related protein Rab-18 OS=Pongo abelii GN=RAB18 PE=2 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 4.052e-36
Identity = 79/146 (54.11%), Postives = 98/146 (67.12%), Query Frame = 1
Query:    4 AIWDTAGQERFRTLTSSYYRGAQGIIMVYDVTRRDTFTNLSDVWAKEIDLYSTNQDCIKLLVGNKVDKESERVVTKKEGINFAREYGCLFIECSAKTRVNVQQCFEELVLKILDTPSLLAEGSKGLKKNIFKQKPPEADAAASGCC 441
            AIWDTAGQERFRTLT SYYRGAQG+I+VYDVTRRDTF  L D W  E++ Y T  D + +LVGNK+DKE+ R V + EG+ FAR++  LFIE SAKT   VQ  FEELV KI+ TP L    ++     +  ++  +   A  G C
Sbjct:   60 AIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKL-DNWLNELETYCTRNDIVNMLVGNKIDKEN-REVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYC 203          
BLAST of CK932608 vs. ExPASy Swiss-Prot
Match: RAB18_HUMAN (Ras-related protein Rab-18 OS=Homo sapiens GN=RAB18 PE=1 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 4.052e-36
Identity = 79/146 (54.11%), Postives = 98/146 (67.12%), Query Frame = 1
Query:    4 AIWDTAGQERFRTLTSSYYRGAQGIIMVYDVTRRDTFTNLSDVWAKEIDLYSTNQDCIKLLVGNKVDKESERVVTKKEGINFAREYGCLFIECSAKTRVNVQQCFEELVLKILDTPSLLAEGSKGLKKNIFKQKPPEADAAASGCC 441
            AIWDTAGQERFRTLT SYYRGAQG+I+VYDVTRRDTF  L D W  E++ Y T  D + +LVGNK+DKE+ R V + EG+ FAR++  LFIE SAKT   VQ  FEELV KI+ TP L    ++     +  ++  +   A  G C
Sbjct:   60 AIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKL-DNWLNELETYCTRNDIVNMLVGNKIDKEN-REVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQGGGACGGYC 203          
BLAST of CK932608 vs. ExPASy Swiss-Prot
Match: RAB18_BOVIN (Ras-related protein Rab-18 OS=Bos taurus GN=RAB18 PE=2 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 4.052e-36
Identity = 79/146 (54.11%), Postives = 98/146 (67.12%), Query Frame = 1
Query:    4 AIWDTAGQERFRTLTSSYYRGAQGIIMVYDVTRRDTFTNLSDVWAKEIDLYSTNQDCIKLLVGNKVDKESERVVTKKEGINFAREYGCLFIECSAKTRVNVQQCFEELVLKILDTPSLLAEGSKGLKKNIFKQKPPEADAAASGCC 441
            AIWDTAGQERFRTLT SYYRGAQG+I+VYDVTRRDTF  L D W  E++ Y T  D + +LVGNK+DKE+ R V + EG+ FAR++  LFIE SAKT   VQ  FEELV KI+ TP L    ++     +  ++  +   A  G C
Sbjct:   60 AIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKL-DNWLNELETYCTRNDIVNMLVGNKIDKEN-REVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLTHREEGQGGGACGGYC 203          
BLAST of CK932608 vs. ExPASy Swiss-Prot
Match: RAB18_RAT (Ras-related protein Rab-18 OS=Rattus norvegicus GN=Rab18 PE=2 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 5.292e-36
Identity = 79/146 (54.11%), Postives = 97/146 (66.44%), Query Frame = 1
Query:    4 AIWDTAGQERFRTLTSSYYRGAQGIIMVYDVTRRDTFTNLSDVWAKEIDLYSTNQDCIKLLVGNKVDKESERVVTKKEGINFAREYGCLFIECSAKTRVNVQQCFEELVLKILDTPSLLAEGSKGLKKNIFKQKPPEADAAASGCC 441
            AIWDTAGQERFRTLT SYYRGAQG+I+VYDVTRRDTF  L D W  E++ Y T  D + +LVGNK+DKE+ R V + EG+ FAR++  LFIE SAKT   VQ  FEELV KI+ TP L    ++     +  ++      A  G C
Sbjct:   60 AIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKL-DNWLNELETYCTRNDIVNMLVGNKIDKEN-REVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSPREESHGGGACGGYC 203          
BLAST of CK932608 vs. ExPASy Swiss-Prot
Match: RAB18_MOUSE (Ras-related protein Rab-18 OS=Mus musculus GN=Rab18 PE=2 SV=2)

HSP 1 Score: 151.369 bits (381), Expect = 5.292e-36
Identity = 79/146 (54.11%), Postives = 97/146 (66.44%), Query Frame = 1
Query:    4 AIWDTAGQERFRTLTSSYYRGAQGIIMVYDVTRRDTFTNLSDVWAKEIDLYSTNQDCIKLLVGNKVDKESERVVTKKEGINFAREYGCLFIECSAKTRVNVQQCFEELVLKILDTPSLLAEGSKGLKKNIFKQKPPEADAAASGCC 441
            AIWDTAGQERFRTLT SYYRGAQG+I+VYDVTRRDTF  L D W  E++ Y T  D + +LVGNK+DKE+ R V + EG+ FAR++  LFIE SAKT   VQ  FEELV KI+ TP L    ++     +  ++      A  G C
Sbjct:   60 AIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKL-DNWLNELETYCTRNDIVNMLVGNKIDKEN-REVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREESRGGGACGGYC 203          
BLAST of CK932608 vs. ExPASy Swiss-Prot
Match: RB18A_LYMST (Ras-related protein Rab-18A OS=Lymnaea stagnalis GN=RAB18A PE=2 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 2.224e-34
Identity = 74/126 (58.73%), Postives = 91/126 (72.22%), Query Frame = 1
Query:    4 AIWDTAGQERFRTLTSSYYRGAQGIIMVYDVTRRDTFTNLSDVWAKEIDLYSTNQDCIKLLVGNKVDKESERVVTKKEGINFAREYGCLFIECSAKTRVNVQQCFEELVLKILDTPSLLAEGSKGL 381
            AIWDTAGQERFRTLT SYYRGAQG+I+VYDV+ + +F  L D W  E++ +ST  D +K+LVGNK+D+ +   VTK EG+ FAR++  LFIE SAKT   VQ  FEELV KI+ TP L    SK L
Sbjct:   61 AIWDTAGQERFRTLTPSYYRGAQGVILVYDVSSKQSFNKL-DAWLNELETFSTKHDMVKMLVGNKIDRANHE-VTKDEGLKFARKHHMLFIEASAKTNDGVQCAFEELVEKIIQTPGLWETSSKNL 184          
BLAST of CK932608 vs. ExPASy Swiss-Prot
Match: RAB18_CAEEL (Ras-related protein Rab-18 OS=Caenorhabditis elegans GN=rab-18 PE=2 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 3.211e-33
Identity = 75/146 (51.37%), Postives = 96/146 (65.75%), Query Frame = 1
Query:    4 AIWDTAGQERFRTLTSSYYRGAQGIIMVYDVTRRDTFTNLSDVWAKEIDLYSTNQDCIKLLVGNKVDKESERVVTKKEGINFAREYGCLFIECSAKTRVNVQQCFEELVLKILDTPSLLAEGSKGLKKNIFKQKPPEADAAASGCC 441
            AIWDTAGQERFRTLT SYYRGAQG+I VYDVT R +F  L+  W +E+D Y TN + IK++V NK+D  + RVVT++EG+ FA+ +  LFIE SAKT+  VQ  FEEL+ KI+ TP L         +  F+   P   +   G C
Sbjct:   63 AIWDTAGQERFRTLTPSYYRGAQGVICVYDVTSRSSFEKLNH-WMQEVDTYCTNDNIIKMMVANKIDMPN-RVVTREEGLKFAKRHRTLFIEASAKTKEGVQCTFEELIEKIIQTPDLWDN-----DRPSFRLGQPTGSSGGGGMC 201          
The following BLAST results are available for this feature:
BLAST of CK932608 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 477
Match NameE-valueIdentityDescription
YPTV3_VOLCA3.916e-3963.71GTP-binding protein yptV3 OS=Volvox carteri GN=YPT... [more]
RB18B_DANRE4.787e-3755.17Ras-related protein Rab-18-B OS=Danio rerio GN=rab... [more]
RAB18_CHICK6.252e-3755.48Ras-related protein Rab-18 OS=Gallus gallus GN=RAB... [more]
RAB18_PONAB4.052e-3654.11Ras-related protein Rab-18 OS=Pongo abelii GN=RAB1... [more]
RAB18_HUMAN4.052e-3654.11Ras-related protein Rab-18 OS=Homo sapiens GN=RAB1... [more]
RAB18_BOVIN4.052e-3654.11Ras-related protein Rab-18 OS=Bos taurus GN=RAB18 ... [more]
RAB18_RAT5.292e-3654.11Ras-related protein Rab-18 OS=Rattus norvegicus GN... [more]
RAB18_MOUSE5.292e-3654.11Ras-related protein Rab-18 OS=Mus musculus GN=Rab1... [more]
RB18A_LYMST2.224e-3458.73Ras-related protein Rab-18A OS=Lymnaea stagnalis G... [more]
RAB18_CAEEL3.211e-3351.37Ras-related protein Rab-18 OS=Caenorhabditis elega... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit juice sac at 38 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004531_G12 Developing fruit juice sac at 38 DAFB Citrus sinensis cDNA clone JSJune0002_IIIF_G12 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK932608 ID=CK932608|Name=CK932608|organism=Citrus sinensis|type=EST|length=778bp
GGGGCAATTTGGGATACAGCTGGTCAGGAGAGATTTCGGACATTGACTAG
TTCATACTACAGGGGTGCACAAGGCATCATTATGGTTTATGATGTTACAA
GGCGAGACACATTTACTAATCTTTCTGATGTATGGGCTAAGGAAATTGAC
TTATACTCAACAAACCAAGATTGTATCAAATTGCTCGTTGGAAACAAAGT
TGATAAGGAAAGTGAAAGGGTTGTGACAAAGAAAGAGGGCATAAACTTTG
CGAGGGAATATGGATGCCTTTTTATTGAATGCAGTGCTAAAACTCGTGTC
AACGTACAGCAGTGCTTTGAAGAGCTTGTTCTAAAGATTTTAGATACACC
AAGCCTCTTGGCGGAGGGATCCAAAGGTTTGAAGAAGAACATCTTTAAAC
AGAAGCCACCAGAAGCTGATGCAGCTGCAAGCGGTTGTTGCTGATTCTTA
TTACTTGCTGAATTTCCCTCACATCACGTCCTACCCTCTAACTTAAGTGT
GGTCTTTCCTCTTTTAATCCCAAAGAAATTATTTATTTTATTATAGTTTA
TTATGAACTGCAGTGCTGATTACATGTAATATAGTAATGCTGTGATTCAT
GCTGCCTCTCCAGACTCATTTTGTCGACATTGAACAACATTTCATTCCTT
TTTTCAAGTCTTGAAATAGTCACTGATATGGCCGTACAGATTTGATCTCC
ATTTGCTCTTAAATCTTACAATGGTAATAGAGGTGAATTTGAGTGAGGTA
AAAAAAAAAAAAAAAAAAAAAAAAAAAA
back to top