CK933020

Overview
NameCK933020
Unique NameCK933020
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length818
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CK933020_ssr80 microsatellite CK933020_ssr80:80..97. BLAST: Citrus ESTs to Prunus persica proteins V1
CK933020_ssr70 microsatellite CK933020_ssr70:70..81. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig10798 contig Csv1_Contig10798:1..808. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK933020 vs. ExPASy Swiss-Prot
Match: PALY_POPTR (Phenylalanine ammonia-lyase OS=Populus trichocarpa GN=PAL PE=2 SV=1)

HSP 1 Score: 340.887 bits (873), Expect = 5.135e-93
Identity = 175/219 (79.91%), Postives = 190/219 (86.76%), Query Frame = 1
Query:  169 TENGHQNGGLEGLCKNDNYNYSSGDALNWGVMAETLKGSHLEEVKRMVAEYRKPVVNLGGETLTVAQVAAIA---TSSTNVELSESAREGV*ASSNWVMESMNKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGIFGNGTESSHTLPHSTTRAAMLVRVNTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLVPLSYIAXXLTG 816
            T+NG+QNG LE LC N        D L+WGV AE +KGSHL+EVKRMVA+YRKPVV LGGETLT+AQVA+IA   T    VELSESAR GV ASS+WVM+SM+KGTDSYGVTTGFGATSHRRTK GGALQKELIRFLNAGIFGNGTE+ HTLPHS TRAAMLVR+NTLLQGYSGIRFEILEAIT+LLN+NITPCLPLRGTITASGDLVPLSYIA  LTG
Sbjct:    5 TKNGYQNGSLESLCVNQR------DPLSWGVAAEAMKGSHLDEVKRMVADYRKPVVKLGGETLTIAQVASIAGHDTGDVKVELSESARPGVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTETCHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITRLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTG 217          
BLAST of CK933020 vs. ExPASy Swiss-Prot
Match: PAL1_PEA (Phenylalanine ammonia-lyase 1 OS=Pisum sativum GN=PAL1 PE=2 SV=1)

HSP 1 Score: 332.413 bits (851), Expect = 1.826e-90
Identity = 173/217 (79.72%), Postives = 186/217 (85.71%), Query Frame = 1
Query:  184 QNGGLEGLC----KNDNYNYSSGDALNWGVMAETLKGSHLEEVKRMVAEYRKPVVNLGGETLTVAQVAAIATSS--TNVELSESAREGV*ASSNWVMESMNKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGIFGNGTESSHTLPHSTTRAAMLVRVNTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLVPLSYIAXXLTG 816
            +N G E  C    KN+N   +S D LNWGV AE +KGSHL+EVKRMV EYRKPVV LGGETLT++QVAAIA       VELSESAR GV ASS+WVMESMNKGTDSYGVTTGFGATSHRRTK GGALQKELIRFLNAGIFGNGTESSHTLPH+ TRAAMLVR+NTLLQGYSGIRFEILEAITKL+N+N+TPCL LRGTITASGDLVPLSYIA  LTG
Sbjct:   10 KNNGYESFCVTNAKNNNMKVNSADPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGETLTISQVAAIAAHDHGVKVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTESSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLINNNVTPCL-LRGTITASGDLVPLSYIAGLLTG 225          
BLAST of CK933020 vs. ExPASy Swiss-Prot
Match: PALY_TRISU (Phenylalanine ammonia-lyase OS=Trifolium subterraneum GN=PAL1 PE=3 SV=1)

HSP 1 Score: 330.872 bits (847), Expect = 5.314e-90
Identity = 168/201 (83.58%), Postives = 180/201 (89.55%), Query Frame = 1
Query:  217 DNYNYSSGDALNWGVMAETLKGSHLEEVKRMVAEYRKPVVNLGGETLTVAQVAAIAT-SSTNVELSESAREGV*ASSNWVMESMNKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGIFGNGTESSHTLPHSTTRAAMLVRVNTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLVPLSYIAXXLTG 816
            +N   ++ D LNWGV AE +KGSHL+EVKRMV EYRKPVV LGGETLT++QVAAIA      VELSESAR GV ASS+WVMESMNKGTDSYGVTTGFGATSHRRTK GGALQKELIRFLNAGIFGNGTES+HTLPH+ TRAAMLVR+NTLLQGYSGIRFEILEAITKLLN+NITPCLPLRGTITASGDLVPLSYIA  LTG
Sbjct:   27 NNMKVNAADPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGETLTISQVAAIAAHDGATVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTESNHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNITPCLPLRGTITASGDLVPLSYIAGLLTG 227          
BLAST of CK933020 vs. ExPASy Swiss-Prot
Match: PAL5_SOLLC (Phenylalanine ammonia-lyase OS=Solanum lycopersicum GN=PAL5 PE=3 SV=1)

HSP 1 Score: 330.487 bits (846), Expect = 6.940e-90
Identity = 170/220 (77.27%), Postives = 188/220 (85.45%), Query Frame = 1
Query:  172 ENGHQNGGLEGLCKNDNYNYSSGDALNWGVMAETLKGSHLEEVKRMVAEYRKPVVNLGGETLTVAQVAAIA-----TSSTNVELSESAREGV*ASSNWVMESMNKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGIFGNGTESSHTLPHSTTRAAMLVRVNTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLVPLSYIAXXLTG 816
            +NGH NG    LCK    + +  D LNW + AE+L+GSHL+EVK+MV E+RKP+V LGGETLTVAQVA+IA     ++   VELSESAR GV ASS+WVM+SM KGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAG+FGNGTESSHTLPHS TRAAMLVR+NTLLQGYSGIRFEILEAITKL+N NITPCLPLRGTITASGDLVPLSYIA  LTG
Sbjct:    7 QNGHVNGEAMDLCKK---SINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGETLTVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNITPCLPLRGTITASGDLVPLSYIAGLLTG 223          
BLAST of CK933020 vs. ExPASy Swiss-Prot
Match: PAL1_SOYBN (Phenylalanine ammonia-lyase 1 OS=Glycine max GN=PAL1 PE=3 SV=1)

HSP 1 Score: 329.331 bits (843), Expect = 1.546e-89
Identity = 173/217 (79.72%), Postives = 182/217 (83.87%), Query Frame = 1
Query:  175 NGHQNGGL-EGLCKNDNYNYSSGDALNWGVMAETLKGSHLEEVKRMVAEYRKPVVNLGGETLTVAQVAAIA--TSSTNVELSESAREGV*ASSNWVMESMNKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGIFGNGTESSHTLPHSTTRAAMLVRVNTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLVPLSYIAXXLTG 816
            NGHQNG       K +N      D LNWG  AE +KGSHL+EVKRMVAEYRKPVV LGGETLT+AQVAA+A       VELSESAREGV ASS WVM SMN GTDSYGVTTGFGATSHRRTK GGALQKELIRFLNAGIFGNGTESSHTLPH+ TRAAMLVR+NTLLQGYSGIRFEILEAITKLLN+N+TPCL LRGTITASGDLVPLSYIA  LTG
Sbjct:    5 NGHQNGSFCLSTAKGNN------DPLNWGAAAEAMKGSHLDEVKRMVAEYRKPVVRLGGETLTIAQVAAVAGHDHGVAVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTESSHTLPHTATRAAMLVRINTLLQGYSGIRFEILEAITKLLNNNVTPCLDLRGTITASGDLVPLSYIAGLLTG 215          
BLAST of CK933020 vs. ExPASy Swiss-Prot
Match: PALY_HELAN (Phenylalanine ammonia-lyase OS=Helianthus annuus GN=PAL PE=2 SV=2)

HSP 1 Score: 328.946 bits (842), Expect = 2.019e-89
Identity = 173/220 (78.64%), Postives = 183/220 (83.18%), Query Frame = 1
Query:  172 ENG-HQNGGLEGLCKNDNYNYSSGDALNWGVMAETLKGSHLEEVKRMVAEYRKPVVNLGGETLTVAQVAAIATSS----TNVELSESAREGV*ASSNWVMESMNKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGIFGNGTESSHTLPHSTTRAAMLVRVNTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLVPLSYIAXXLTG 816
            ENG H NG   G C  D         LNWGV AE L GSHL+EVK+MV E+RKPVV LGGETLTV+QVA I+ +       VELSE+AR GV ASS+WVMESMNKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGIFGNGTESSHTLPHS TRAAMLVR+NTLLQGYSGIRFEILEAITK LN+NITPCLPLRGTITASGDLVPLSYIA  LTG
Sbjct:    2 ENGTHVNGSANGFCIKD--------PLNWGVAAEALTGSHLDEVKKMVGEFRKPVVKLGGETLTVSQVAGISAAGDGNMVKVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGIFGNGTESSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNNNITPCLPLRGTITASGDLVPLSYIAGLLTG 213          
BLAST of CK933020 vs. ExPASy Swiss-Prot
Match: PAL1_TOBAC (Phenylalanine ammonia-lyase OS=Nicotiana tabacum GN=TPA1 PE=2 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 4.498e-89
Identity = 171/220 (77.73%), Postives = 187/220 (85.00%), Query Frame = 1
Query:  175 NGHQNGGLE-GLCKNDNYNYSSGDALNWGVMAETLKGSHLEEVKRMVAEYRKPVVNLGGETLTVAQVAAIAT-----SSTNVELSESAREGV*ASSNWVMESMNKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGIFGNGTESSHTLPHSTTRAAMLVRVNTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLVPLSYIAXXLTG 816
            NGH NGG    LCK       S D LNW + AE+L+GSHL+EVK+MV+E+RKP+V LGGE+LTVAQVAAIA      +   VELSE AR GV ASS+WVM+SMNKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAG+FGNGTE+SHTLPHS TRAAMLVR+NTLLQGYSGIRFEILEAITKL+N NITPCLPLRGTITASGDLVPLSYIA  LTG
Sbjct:    4 NGHVNGGENFELCKK------SADPLNWEMAAESLRGSHLDEVKKMVSEFRKPMVKLGGESLTVAQVAAIAVRDKSANGVKVELSEEARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGVFGNGTETSHTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKLINSNITPCLPLRGTITASGDLVPLSYIAGLLTG 217          
BLAST of CK933020 vs. ExPASy Swiss-Prot
Match: PALY_CAMSI (Phenylalanine ammonia-lyase OS=Camellia sinensis GN=PAL PE=2 SV=1)

HSP 1 Score: 326.635 bits (836), Expect = 1.002e-88
Identity = 173/224 (77.23%), Postives = 183/224 (81.70%), Query Frame = 1
Query:  151 MERGATTENGHQNGGLEGLCKNDNYNYSSGDALNWGVMAETLKGSHLEEVKRMVAEYRKPVVNLGGETLTVAQVAAIAT--SSTNVELSESAREGV*ASSNWVMESMNKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGIFGNGTESSHTLPHSTTRAAMLVRVNTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLVPLSYIAXXLTG 816
            M+      NG  +GG  G C  D         LNWGV AE +KGSHLEEVK MV E+RKPVV LGGETLT++QVAAIA   S   VELSESAREGV ASS+WVMESMNKGTDSYGVTTGFGATSHRRTK GGALQKELIRFLNAGIFGNGTES HTLP S TRAAMLVR+NTLLQGYSGIRFEILEAI+K LN+NITPCLPLRGTITASGDLVPLSYIA  LTG
Sbjct:    1 MDSTTAIGNGVGSGGSPGFCLKD--------PLNWGVAAEAMKGSHLEEVKGMVEEFRKPVVRLGGETLTISQVAAIAVRGSEVAVELSESAREGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKEGGALQKELIRFLNAGIFGNGTESCHTLPQSATRAAMLVRINTLLQGYSGIRFEILEAISKFLNNNITPCLPLRGTITASGDLVPLSYIAGLLTG 216          
BLAST of CK933020 vs. ExPASy Swiss-Prot
Match: PAL1_PRUAV (Phenylalanine ammonia-lyase 1 OS=Prunus avium GN=PAL1 PE=2 SV=1)

HSP 1 Score: 324.324 bits (830), Expect = 4.974e-88
Identity = 170/226 (75.22%), Postives = 186/226 (82.30%), Query Frame = 1
Query:  151 MERGATTENGHQNGGLE--GLCKNDNYNYSSGDALNWGVMAETLKGSHLEEVKRMVAEYRKPVVNLGGETLTVAQVAAIAT--SSTNVELSESAREGV*ASSNWVMESMNKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGIFGNGTESSHTLPHSTTRAAMLVRVNTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLVPLSYIAXXLTG 816
            M   +  +NGH+NG +E   LC          D LNWGV AETLKGSHL+EVKRMVAEYRKPVV LGGE+LT++QVAAIAT  S   VELSESAR GV ASS+WVM+SM+KGTDSYGVTTGFGATSHRRTK G ALQKELIRFLNAG+FG+  ES HTLPH  TRAAMLVR+NTLLQGYSGIRFEILE ITK LN+N+TPCLPLRGTITASGDLVPLSYIA  LTG
Sbjct:    1 MATNSIKQNGHKNGSVELPELCIKK-------DPLNWGVAAETLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQVAAIATHDSGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGVFGSTKESGHTLPHQATRAAMLVRINTLLQGYSGIRFEILEVITKFLNNNVTPCLPLRGTITASGDLVPLSYIAGMLTG 219          
BLAST of CK933020 vs. ExPASy Swiss-Prot
Match: PALY_DIGLA (Phenylalanine ammonia-lyase OS=Digitalis lanata PE=2 SV=1)

HSP 1 Score: 323.553 bits (828), Expect = 8.484e-88
Identity = 170/220 (77.27%), Postives = 180/220 (81.82%), Query Frame = 1
Query:  163 ATTENGHQNGGLEGLCKNDNYNYSSGDALNWGVMAETLKGSHLEEVKRMVAEYRKPVVNLGGETLTVAQVAAIATSSTNV--ELSESAREGV*ASSNWVMESMNKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGIFGNGTESSHTLPHSTTRAAMLVRVNTLLQGYSGIRFEILEAITKLLNHNITPCLPLRGTITASGDLVPLSYIAXXLTG 816
            A  ENGH   G  G C   N      D LNW   AE LKGSHL+EVKRMV E+RK VV LGGETLT++QVAAIA     V  +L+ES+R GV ASS+WVMESMNKGTDSYGVTTGFGATSHRRTK GGALQKELIRFLNAGIFGNGTES+HTLPHS TRAAMLVR+NTLLQGYSGIRFEILE ITK LNHNITPCLPLRGTITASGDLVPLSYIA  LTG
Sbjct:    3 AVVENGHH--GNNGFCVKQN------DPLNWVAAAEELKGSHLDEVKRMVEEFRKTVVKLGGETLTISQVAAIAARDNEVAVQLAESSRAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNGTESTHTLPHSATRAAMLVRINTLLQGYSGIRFEILETITKFLNHNITPCLPLRGTITASGDLVPLSYIAGLLTG 214          
The following BLAST results are available for this feature:
BLAST of CK933020 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 220
Match NameE-valueIdentityDescription
PALY_POPTR5.135e-9379.91Phenylalanine ammonia-lyase OS=Populus trichocarpa... [more]
PAL1_PEA1.826e-9079.72Phenylalanine ammonia-lyase 1 OS=Pisum sativum GN=... [more]
PALY_TRISU5.314e-9083.58Phenylalanine ammonia-lyase OS=Trifolium subterran... [more]
PAL5_SOLLC6.940e-9077.27Phenylalanine ammonia-lyase OS=Solanum lycopersicu... [more]
PAL1_SOYBN1.546e-8979.72Phenylalanine ammonia-lyase 1 OS=Glycine max GN=PA... [more]
PALY_HELAN2.019e-8978.64Phenylalanine ammonia-lyase OS=Helianthus annuus G... [more]
PAL1_TOBAC4.498e-8977.73Phenylalanine ammonia-lyase OS=Nicotiana tabacum G... [more]
PALY_CAMSI1.002e-8877.23Phenylalanine ammonia-lyase OS=Camellia sinensis G... [more]
PAL1_PRUAV4.974e-8875.22Phenylalanine ammonia-lyase 1 OS=Prunus avium GN=P... [more]
PALY_DIGLA8.484e-8877.27Phenylalanine ammonia-lyase OS=Digitalis lanata PE... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit juice sac at 38 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004348_E06 Developing fruit juice sac at 38 DAFB Citrus sinensis cDNA clone JSJune0004_IIF_E06 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933020 ID=CK933020|Name=CK933020|organism=Citrus sinensis|type=EST|length=818bp
GCGGGGAGGAAATCCATTATATTTATAGANNNCAGAATTTCCTTTAGCTC
ATTCATTCTTCATCACTCCCATTCATTCATTCTTCTTCTTCTTCTTCTTT
CTACAGTTTTGGTATTTTTTGTAATTGCAGTAACATTTACGTAAAACGAT
ATGGAGAGAGGTGCCACTACTGAGAATGGTCACCAGAACGGTGGCCTGGA
GGGTTTGTGCAAGAATGACAATTACAATTACAGTTCTGGGGATGCGTTGA
ACTGGGGAGTGATGGCGGAGACGTTGAAGGGGAGCCATTTGGAGGAAGTG
AAGCGTATGGTGGCGGAGTACAGGAAGCCGGTGGTCAACCTCGGTGGTGA
GACGTTGACCGTAGCACAGGTGGCTGCCATTGCCACGTCCTCTACGAATG
TGGAGCTGTCGGAATCTGCCAGGGAAGGCGTCTAGGCCAGCAGTAATTGG
GTGATGGAGAGCATGAATAAGGGTACCGACAGTTACGGCGTTACCACTGG
CTTTGGCGCCACTTCTCATCGGAGAACCAAGAACGGCGGTGCTCTTCAGA
AGGAGCTCATTAGATTTTTGAACGCTGGAATCTTTGGAAACGGAACAGAG
TCATCTCACACGCTACCTCACTCAACAACAAGGGCAGCCATGCTTGTGAG
GGTTAACACTCTTCTCCAGGGCTACTCTGGCATCCGATTTGAAATCCTGG
AAGCGATCACAAAGCTGCTCAATCACAACATCACTCCATGCCTCCCTCTT
CGCGGCACAATCACTGCTTCAGGGGATCTGGTTCCTCTTTCCTACATTGC
CNNNNTGCTCACCGGCCG
back to top