CK933023

Overview
NameCK933023
Unique NameCK933023
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length780
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7013 contig Csv1_Contig7013:1..767. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK933023 vs. ExPASy Swiss-Prot
Match: RL31_ARATH (60S ribosomal protein L3-1 OS=Arabidopsis thaliana GN=ARP1 PE=2 SV=5)

HSP 1 Score: 408.297 bits (1048), Expect = 2.402e-113
Identity = 196/241 (81.33%), Postives = 213/241 (88.38%), Query Frame = 2
Query:   56 MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKDDPSKPCRLTAFLGYKAGMTHIVRDVEKPGSKLHKKETCEAVTIIETXXXXXXXXXXYVKTPRGLRSLNTVWAQHLSEEVRRRFYKNWCXXXXXXXXXXXXQYETDEGKKSIQAQLEKIKKYASVVRVLAHTQIRKMKGLKQKKAHLMEIQVNGGTIAEKVDYAYGFFEKQIPVDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL 778
            MSHRKFEHPRHGSLGFLPRKRA RHRGKVKAFPKDD +KPC+ TAF+GYKAGMTHIVR+VEKPGSKLHKKETCEAVTIIET          YVKTPRGLRSLNTVWAQHLSEEVRRRFYKNW             QY++++GKK IQAQLEK+KKYA+V+RVLAHTQIRKMKGLKQKKAH+MEIQ+NGGTIA+KVD+AY FFEKQIP++AVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL
Sbjct:    1 MSHRKFEHPRHGSLGFLPRKRANRHRGKVKAFPKDDQTKPCKFTAFMGYKAGMTHIVREVEKPGSKLHKKETCEAVTIIETPAMVVVGVVAYVKTPRGLRSLNTVWAQHLSEEVRRRFYKNWAKSKKKAFTGYAKQYDSEDGKKGIQAQLEKMKKYATVIRVLAHTQIRKMKGLKQKKAHMMEIQINGGTIAQKVDFAYSFFEKQIPIEAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL 241          
BLAST of CK933023 vs. ExPASy Swiss-Prot
Match: RL3_ORYSJ (60S ribosomal protein L3 OS=Oryza sativa subsp. japonica GN=RPL3 PE=2 SV=2)

HSP 1 Score: 407.142 bits (1045), Expect = 5.351e-113
Identity = 196/241 (81.33%), Postives = 212/241 (87.97%), Query Frame = 2
Query:   56 MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKDDPSKPCRLTAFLGYKAGMTHIVRDVEKPGSKLHKKETCEAVTIIETXXXXXXXXXXYVKTPRGLRSLNTVWAQHLSEEVRRRFYKNWCXXXXXXXXXXXXQYETDEGKKSIQAQLEKIKKYASVVRVLAHTQIRKMKGLKQKKAHLMEIQVNGGTIAEKVDYAYGFFEKQIPVDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL 778
            MSHRKFEHPRHGSLGFLPRKR++RHRGKVK+FPKDD SKPC LT+F+GYKAGMTHIVR+VEKPGSKLHKKETCEAVTIIET          YVKTPRGLRSLN+VWAQHLSEEVRRRFYKNWC            +Y++D GKK IQ QLEK+KKYAS+VRV+AHTQIRKMKGLKQKKAHLMEIQ+NGGTIA+KVDY Y FFEK+IPVDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL
Sbjct:    1 MSHRKFEHPRHGSLGFLPRKRSSRHRGKVKSFPKDDVSKPCHLTSFVGYKAGMTHIVREVEKPGSKLHKKETCEAVTIIETPPLVIVGLVAYVKTPRGLRSLNSVWAQHLSEEVRRRFYKNWCKSKKKAFTKYALKYDSDAGKKEIQMQLEKMKKYASIVRVIAHTQIRKMKGLKQKKAHLMEIQINGGTIADKVDYGYKFFEKEIPVDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL 241          
BLAST of CK933023 vs. ExPASy Swiss-Prot
Match: RL32_ARATH (60S ribosomal protein L3-2 OS=Arabidopsis thaliana GN=ARP2 PE=2 SV=4)

HSP 1 Score: 402.905 bits (1034), Expect = 1.009e-111
Identity = 196/241 (81.33%), Postives = 210/241 (87.14%), Query Frame = 2
Query:   56 MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKDDPSKPCRLTAFLGYKAGMTHIVRDVEKPGSKLHKKETCEAVTIIETXXXXXXXXXXYVKTPRGLRSLNTVWAQHLSEEVRRRFYKNWCXXXXXXXXXXXXQYETDEGKKSIQAQLEKIKKYASVVRVLAHTQIRKMKGLKQKKAHLMEIQVNGGTIAEKVDYAYGFFEKQIPVDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL 778
            MSHRKFEHPRHGSLGFLPRKRA+RHRGKVKAFPKDDP+KPCRLT+FLGYKAGMTHIVRDVEKPGSKLHKKETCEAVTIIET          YVKTPRGLRSL TVWAQHLSEE+RRRFYKNW             ++ET+EGKK IQ+QLEK+KKY SV+RVLAHTQIRKMKGLKQKKAHL EIQ+NGG IA+KVDYA   FEKQ+PVDA+FQKDEMIDIIGVTKGKGYEGVVTRWGVTRL
Sbjct:    1 MSHRKFEHPRHGSLGFLPRKRASRHRGKVKAFPKDDPTKPCRLTSFLGYKAGMTHIVRDVEKPGSKLHKKETCEAVTIIETPPMVVVGVVGYVKTPRGLRSLCTVWAQHLSEELRRRFYKNWAKSKKKAFTRYSKKHETEEGKKDIQSQLEKMKKYCSVIRVLAHTQIRKMKGLKQKKAHLNEIQINGGDIAKKVDYACSLFEKQVPVDAIFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL 241          
BLAST of CK933023 vs. ExPASy Swiss-Prot
Match: RL3_ASPFU (60S ribosomal protein L3 OS=Aspergillus fumigatus GN=rpl3 PE=1 SV=2)

HSP 1 Score: 315.464 bits (807), Expect = 2.119e-85
Identity = 154/241 (63.90%), Postives = 187/241 (77.59%), Query Frame = 2
Query:   56 MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKDDPSKPCRLTAFLGYKAGMTHIVRDVEKPGSKLHKKETCEAVTIIETXXXXXXXXXXYVKTPRGLRSLNTVWAQHLSEEVRRRFYKNWCXXXXXXXXXXXXQYETDEGKKSIQAQLEKIKKYASVVRVLAHTQIRKMKGLKQKKAHLMEIQVNGGTIAEKVDYAYGFFEKQIPVDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL 778
            MSHRK+E PRHGSL FLPRKRAARHRGKVK+FPKDDP KP  LTA +GYKAGMT +VRD+++PG+K+HKKE  EAVTIIET          Y++TPRGLRSL TVWA+HLS+EV+RRFYKNW             ++  + G  SI  +LE+IKKY +VVRVLAHTQIRK   LKQKKAHLMEIQVNGG++A+KVD+A   FEK I +D++F+KDEMID+I VTKG G++GV +RWG  +L
Sbjct:    1 MSHRKYEAPRHGSLAFLPRKRAARHRGKVKSFPKDDPKKPVHLTASMGYKAGMTTVVRDLDRPGAKMHKKEIVEAVTIIETPPLVAVGVVGYIETPRGLRSLTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYAKKHAEENG-ASITRELERIKKYCTVVRVLAHTQIRKTP-LKQKKAHLMEIQVNGGSVADKVDFARNLFEKPIEIDSIFEKDEMIDVIAVTKGHGFQGVTSRWGTKKL 239          
BLAST of CK933023 vs. ExPASy Swiss-Prot
Match: RL3B_SCHPO (60S ribosomal protein L3-B OS=Schizosaccharomyces pombe GN=rpl3b PE=2 SV=2)

HSP 1 Score: 313.153 bits (801), Expect = 1.052e-84
Identity = 158/241 (65.56%), Postives = 184/241 (76.35%), Query Frame = 2
Query:   56 MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKDDPSKPCRLTAFLGYKAGMTHIVRDVEKPGSKLHKKETCEAVTIIETXXXXXXXXXXYVKTPRGLRSLNTVWAQHLSEEVRRRFYKNWCXXXXXXXXXXXXQYETDEGKKSIQAQLEKIKKYASVVRVLAHTQIRKMKGLKQKKAHLMEIQVNGGTIAEKVDYAYGFFEKQIPVDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL 778
            MSH KFE PRHGSLGFLPRKRA+R RGKVKAFPKDD SKP  LTAFLGYKAGMTHIVRD+++PGSK+HK+E  EAVTIIET          YV+TPRGLRSL TVWA+HLSEEV+RRFYKNW             +Y   E  +SI  +LE+IKKY SVVRVLAHTQIRK   L QKKAHLMEIQVNGG++A+KV++A   FEK + + + F+++EMID+IGVT+GKG EG   RWG  RL
Sbjct:    1 MSHCKFEQPRHGSLGFLPRKRASRQRGKVKAFPKDDASKPVHLTAFLGYKAGMTHIVRDLDRPGSKMHKREILEAVTIIETPPMVVVGVVGYVETPRGLRSLTTVWAEHLSEEVKRRFYKNWFKSKKKAFTKYAKKYA--ESTQSINRELERIKKYCSVVRVLAHTQIRKTP-LAQKKAHLMEIQVNGGSVADKVEWAREHFEKTVDIKSTFEQNEMIDVIGVTRGKGNEGTTARWGTKRL 238          
BLAST of CK933023 vs. ExPASy Swiss-Prot
Match: RL3A_SCHPO (60S ribosomal protein L3-A OS=Schizosaccharomyces pombe GN=rpl3a PE=1 SV=2)

HSP 1 Score: 312.768 bits (800), Expect = 1.374e-84
Identity = 157/241 (65.15%), Postives = 184/241 (76.35%), Query Frame = 2
Query:   56 MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKDDPSKPCRLTAFLGYKAGMTHIVRDVEKPGSKLHKKETCEAVTIIETXXXXXXXXXXYVKTPRGLRSLNTVWAQHLSEEVRRRFYKNWCXXXXXXXXXXXXQYETDEGKKSIQAQLEKIKKYASVVRVLAHTQIRKMKGLKQKKAHLMEIQVNGGTIAEKVDYAYGFFEKQIPVDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL 778
            MSH KFE PRHGSLGFLPRKRA+R RGKVKAFPKDD SKP  LTAFLGYKAGMTHIVRD+++PGSK+HK+E  EAVT+IET          YV+TPRGLRSL TVWA+HLSEEV+RRFYKNW             +Y   E  +SI  +LE+IKKY SVVRVLAHTQIRK   L QKKAHLMEIQVNGG++A+KV++A   FEK + + + F+++EMID+IGVT+GKG EG   RWG  RL
Sbjct:    1 MSHCKFEQPRHGSLGFLPRKRASRQRGKVKAFPKDDASKPVHLTAFLGYKAGMTHIVRDLDRPGSKMHKREILEAVTVIETPPMVVVGVVGYVETPRGLRSLTTVWAEHLSEEVKRRFYKNWFKSKKKAFTKYAKKYA--ESTQSINRELERIKKYCSVVRVLAHTQIRKTP-LAQKKAHLMEIQVNGGSVADKVEWAREHFEKTVDIKSTFEQNEMIDVIGVTRGKGNEGTTARWGTKRL 238          
BLAST of CK933023 vs. ExPASy Swiss-Prot
Match: RL3_RAT (60S ribosomal protein L3 OS=Rattus norvegicus GN=Rpl3 PE=1 SV=3)

HSP 1 Score: 308.916 bits (790), Expect = 1.983e-83
Identity = 147/241 (61.00%), Postives = 186/241 (77.18%), Query Frame = 2
Query:   56 MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKDDPSKPCRLTAFLGYKAGMTHIVRDVEKPGSKLHKKETCEAVTIIETXXXXXXXXXXYVKTPRGLRSLNTVWAQHLSEEVRRRFYKNWCXXXXXXXXXXXXQYETDEGKKSIQAQLEKIKKYASVVRVLAHTQIRKMKGLKQKKAHLMEIQVNGGTIAEKVDYAYGFFEKQIPVDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL 778
            MSHRKF  PRHGSLGFLPRKR++RHRGKVK+FPKDDPSKP  LTAFLGYKAGMTHIVR+V++PGSK++KKE  EAVTI+ET          YV+TPRGLR+  TV+A+H+S+E +RRFYKNW             +++ D GKK ++     +KKY  V+R++AHTQ+R +  L+QKKAHLMEIQVNGGT+AEK+D+A    E+Q+PV+ VF +DEMID+IGVTKGKGY+GV +RW   +L
Sbjct:    1 MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYKNWHKSKKKAFTKYCKKWQDDTGKKQLEKDFNSMKKYCQVIRIIAHTQMRLLP-LRQKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKL 240          
BLAST of CK933023 vs. ExPASy Swiss-Prot
Match: RL3_HUMAN (60S ribosomal protein L3 OS=Homo sapiens GN=RPL3 PE=1 SV=2)

HSP 1 Score: 308.916 bits (790), Expect = 1.983e-83
Identity = 147/241 (61.00%), Postives = 187/241 (77.59%), Query Frame = 2
Query:   56 MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKDDPSKPCRLTAFLGYKAGMTHIVRDVEKPGSKLHKKETCEAVTIIETXXXXXXXXXXYVKTPRGLRSLNTVWAQHLSEEVRRRFYKNWCXXXXXXXXXXXXQYETDEGKKSIQAQLEKIKKYASVVRVLAHTQIRKMKGLKQKKAHLMEIQVNGGTIAEKVDYAYGFFEKQIPVDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL 778
            MSHRKF  PRHGSLGFLPRKR++RHRGKVK+FPKDDPSKP  LTAFLGYKAGMTHIVR+V++PGSK++KKE  EAVTI+ET          YV+TPRGLR+  TV+A+H+S+E +RRFYKNW             +++ ++GKK ++     +KKY  V+RV+AHTQ+R +  L+QKKAHLMEIQVNGGT+AEK+D+A    E+Q+PV+ VF +DEMID+IGVTKGKGY+GV +RW   +L
Sbjct:    1 MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYKNWHKSKKKAFTKYCKKWQDEDGKKQLEKDFSSMKKYCQVIRVIAHTQMRLLP-LRQKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKL 240          
BLAST of CK933023 vs. ExPASy Swiss-Prot
Match: RL3_MACFA (60S ribosomal protein L3 OS=Macaca fascicularis GN=RPL3 PE=2 SV=3)

HSP 1 Score: 306.22 bits (783), Expect = 1.286e-82
Identity = 146/241 (60.58%), Postives = 186/241 (77.18%), Query Frame = 2
Query:   56 MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKDDPSKPCRLTAFLGYKAGMTHIVRDVEKPGSKLHKKETCEAVTIIETXXXXXXXXXXYVKTPRGLRSLNTVWAQHLSEEVRRRFYKNWCXXXXXXXXXXXXQYETDEGKKSIQAQLEKIKKYASVVRVLAHTQIRKMKGLKQKKAHLMEIQVNGGTIAEKVDYAYGFFEKQIPVDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL 778
            MSHRKF  PRHGSLGFLPRKR++RHRGKVK+FPKDDPSKP  LTAFLGYKAGMTHIVR+V++PGSK++KKE   AVTI+ET          YV+TPRGLR+  TV+A+H+S+E +RRFYKNW             +++ ++GKK ++     +KKY  V+RV+AHTQ+R +  L+QKKAHLMEIQVNGGT+AEK+D+A    E+Q+PV+ VF +DEMID+IGVTKGKGY+GV +RW   +L
Sbjct:    1 MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNKKEVVVAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYKNWHKSKKKAFTKYCKKWQDEDGKKQLEKDFSSMKKYCQVIRVIAHTQMRLLP-LRQKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKL 240          
BLAST of CK933023 vs. ExPASy Swiss-Prot
Match: RL3_MOUSE (60S ribosomal protein L3 OS=Mus musculus GN=Rpl3 PE=2 SV=2)

HSP 1 Score: 305.834 bits (782), Expect = 1.679e-82
Identity = 146/241 (60.58%), Postives = 185/241 (76.76%), Query Frame = 2
Query:   56 MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKDDPSKPCRLTAFLGYKAGMTHIVRDVEKPGSKLHKKETCEAVTIIETXXXXXXXXXXYVKTPRGLRSLNTVWAQHLSEEVRRRFYKNWCXXXXXXXXXXXXQYETDEGKKSIQAQLEKIKKYASVVRVLAHTQIRKMKGLKQKKAHLMEIQVNGGTIAEKVDYAYGFFEKQIPVDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL 778
            MSHRKF  PRHGSLGFLPRKR++RHRGKVK+FPKDD SKP  LTAFLGYKAGMTHIVR+V++PGSK++KKE  EAVTI+ET          YV+TPRGLR+  TV+A+H+S+E +RRFYKNW             +++ D GKK ++     +KKY  V+R++AHTQ+R +  L+QKKAHLMEIQVNGGT+AEK+D+A    E+Q+PV+ VF +DEMID+IGVTKGKGY+GV +RW   +L
Sbjct:    1 MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDASKPVHLTAFLGYKAGMTHIVREVDRPGSKVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYKNWHKSKKKAFTKYCKKWQDDTGKKQLEKDFNSMKKYCQVIRIIAHTQMRLLP-LRQKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKL 240          
The following BLAST results are available for this feature:
BLAST of CK933023 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 81
Match NameE-valueIdentityDescription
RL31_ARATH2.402e-11381.3360S ribosomal protein L3-1 OS=Arabidopsis thaliana... [more]
RL3_ORYSJ5.351e-11381.3360S ribosomal protein L3 OS=Oryza sativa subsp. ja... [more]
RL32_ARATH1.009e-11181.3360S ribosomal protein L3-2 OS=Arabidopsis thaliana... [more]
RL3_ASPFU2.119e-8563.9060S ribosomal protein L3 OS=Aspergillus fumigatus ... [more]
RL3B_SCHPO1.052e-8465.5660S ribosomal protein L3-B OS=Schizosaccharomyces ... [more]
RL3A_SCHPO1.374e-8465.1560S ribosomal protein L3-A OS=Schizosaccharomyces ... [more]
RL3_RAT1.983e-8361.0060S ribosomal protein L3 OS=Rattus norvegicus GN=R... [more]
RL3_HUMAN1.983e-8361.0060S ribosomal protein L3 OS=Homo sapiens GN=RPL3 P... [more]
RL3_MACFA1.286e-8260.5860S ribosomal protein L3 OS=Macaca fascicularis GN... [more]
RL3_MOUSE1.679e-8260.5860S ribosomal protein L3 OS=Mus musculus GN=Rpl3 P... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit juice sac at 38 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004348_E09 Developing fruit juice sac at 38 DAFB Citrus sinensis cDNA clone JSJune0004_IIF_E09 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933023 ID=CK933023|Name=CK933023|organism=Citrus sinensis|type=EST|length=780bp
GGGGCCAGCTCTAGACCATAACGAGTCAGTCGCCGCAGCAGCTCAGAGGA
GGAGAATGTCTCACAGGAAGTTTGAGCACCCAAGGCATGGTTCCCTTGGA
TTTCTTCCAAGGAAGAGAGCTGCTCGTCACAGAGGAAAGGTGAAGGCTTT
TCCCAAGGATGACCCAAGCAAGCCTTGCAGGCTCACTGCCTTTTTGGGTT
ACAAGGCTGGGATGACCCACATTGTTAGGGATGTCGAGAAACCTGGATCT
AAGCTTCACAAGAAGGAGACCTGTGAGGCTGTTACCATTATTGAAACCCC
TCCAATGATGGTGGTTGGAGTTGTGGGATATGTGAAGACACCTCGTGGTC
TTCGCTCTTTGAACACTGTATGGGCTCAGCATCTTAGTGAGGAGGTGAGA
AGAAGGTTCTACAAGAACTGGTGCAAATCCAAGAAGAAGGCTTTCACAAA
ATACTCAAAGCAGTATGAGACAGATGAAGGGAAGAAAAGTATCCAAGCTC
AGCTGGAGAAGATCAAGAAGTATGCATCTGTTGTTCGTGTTCTTGCTCAC
ACTCAGATTAGGAAAATGAAGGGTTTGAAGCAGAAGAAGGCACACCTGAT
GGAAATCCAGGTCAATGGTGGCACCATTGCTGAAAAAGTTGACTATGCAT
ATGGCTTCTTTGAAAAGCAAATTCCTGTTGATGCTGTTTTCCAGAAGGAT
GAGATGATTGACATCATCGGTGTCACGAAAGGTAAAGGTTATGAAGGTGT
TGTCACCCGTTGGGGTGTTACCCGCCTTCC
back to top