CK933031

Overview
NameCK933031
Unique NameCK933031
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length567
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CK933031_ssr13 microsatellite CK933031_ssr13:13..24. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig6871 contig Csv1_Contig6871:37..607. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK933031 vs. ExPASy Swiss-Prot
Match: NDUA2_BOVIN (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 OS=Bos taurus GN=NDUFA2 PE=1 SV=2)

HSP 1 Score: 45.4394 bits (106), Expect = 2.225e-11
Identity = 17/40 (42.50%), Postives = 29/40 (72.50%), Query Frame = 2
Query:  176 CSGIEPQLWARYDMGVEKGIGLDGLNEAQITKALEDLVKA 295
            CS ++P+LWARY  G EK + L+  +  Q+T+ALE+++ +
Sbjct:   58 CSDVQPKLWARYAFGQEKNVSLNNFSADQVTRALENVLSS 97          

HSP 2 Score: 43.5134 bits (101), Expect = 2.225e-11
Identity = 23/48 (47.92%), Postives = 29/48 (60.42%), Query Frame = 3
Query:   33 RGQLSRSMKELRILLCQXXXXXXXXXXFVERNYKELKTLNPKLPILIR 176
            RG+L   ++E+RI LCQ          F+E+ Y ELK  NP LPILIR
Sbjct:   11 RGKLG--LREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIR 56          
BLAST of CK933031 vs. ExPASy Swiss-Prot
Match: NDUA2_PONPY (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 OS=Pongo pygmaeus GN=NDUFA2 PE=3 SV=1)

HSP 1 Score: 46.2098 bits (108), Expect = 2.890e-11
Identity = 18/39 (46.15%), Postives = 29/39 (74.36%), Query Frame = 2
Query:  176 CSGIEPQLWARYDMGVEKGIGLDGLNEAQITKALEDLVK 292
            CS ++P+LWARY  G EK + L+  +  Q+T+ALE+++K
Sbjct:   58 CSDVQPKLWARYAFGQEKNVPLNNFSADQVTRALENVLK 96          

HSP 2 Score: 42.3578 bits (98), Expect = 2.890e-11
Identity = 20/41 (48.78%), Postives = 25/41 (60.98%), Query Frame = 3
Query:   54 MKELRILLCQXXXXXXXXXXFVERNYKELKTLNPKLPILIR 176
            ++E+RI LCQ          F+E+ Y ELK  NP LPILIR
Sbjct:   16 LREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIR 56          
BLAST of CK933031 vs. ExPASy Swiss-Prot
Match: NDUA2_PONAB (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 OS=Pongo abelii GN=NDUFA2 PE=3 SV=1)

HSP 1 Score: 46.2098 bits (108), Expect = 2.890e-11
Identity = 18/39 (46.15%), Postives = 29/39 (74.36%), Query Frame = 2
Query:  176 CSGIEPQLWARYDMGVEKGIGLDGLNEAQITKALEDLVK 292
            CS ++P+LWARY  G EK + L+  +  Q+T+ALE+++K
Sbjct:   58 CSDVQPKLWARYAFGQEKNVPLNNFSADQVTRALENVLK 96          

HSP 2 Score: 42.3578 bits (98), Expect = 2.890e-11
Identity = 20/41 (48.78%), Postives = 25/41 (60.98%), Query Frame = 3
Query:   54 MKELRILLCQXXXXXXXXXXFVERNYKELKTLNPKLPILIR 176
            ++E+RI LCQ          F+E+ Y ELK  NP LPILIR
Sbjct:   16 LREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIR 56          
The following BLAST results are available for this feature:
BLAST of CK933031 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
NDUA2_BOVIN2.225e-1142.50NADH dehydrogenase [ubiquinone] 1 alpha subcomplex... [more]
NDUA2_PONPY2.890e-1146.15NADH dehydrogenase [ubiquinone] 1 alpha subcomplex... [more]
NDUA2_PONAB2.890e-1146.15NADH dehydrogenase [ubiquinone] 1 alpha subcomplex... [more]
back to top
Libraries
Library NameType
Developing fruit juice sac at 38 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004348_D11 Developing fruit juice sac at 38 DAFB Citrus sinensis cDNA clone JSJune0004_IIF_D11 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933031 ID=CK933031|Name=CK933031|organism=Citrus sinensis|type=EST|length=567bp
GGGGGAGCGAGCGAGAGAGAGAGATGGCATGGAGAGGACAATTATCTCGG
AGCATGAAGGAACTGAGGATCTTACTCTGCCAGACTTCTCCTTCAAGCTC
CTCCACTAGATCCTTTGTAGAGAGGAACTACAAGGAGTTGAAGACTTTAA
ACCCCAAACTTCCTATCTTGATTCGTGCAGTGGGATTGAGCCCCAGTTAT
GGGCTAGATATGATATGGGTGTTGAGAAGGGCATTGGTTTGGATGGTCTG
AATGAGGCACAGATCACAAAGGCACTCGAAGACCTTGTCAAAGCTGGGGA
AGCCCTTAAGCGTTGATATTGCTACTCTTTGATCCATATGAGATGAAATA
AATGTGTTAGAAAAATCTTGATATGACCAGTTTGCTCTTTTGTTTAGCAA
TCATTTTGATGTACTTTGCATGGTTGTCCAATATCTTGATTATTGTCTGC
ATTAGCATATTATACTCTCATCCATATCTTTCAGCTCAATTAGTGCTAAT
GTAATACCAAAATAACACTGATCAGGGATTATCTTTGAGAAAAAAAAAAA
AAAAAAAAAAAAAAAAA
back to top