CK933032

Overview
NameCK933032
Unique NameCK933032
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length770
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1516 contig Csv1_Contig1516:1..770. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK933032 vs. ExPASy Swiss-Prot
Match: RS3A_HELAN (40S ribosomal protein S3a OS=Helianthus annuus GN=RPS3A PE=2 SV=2)

HSP 1 Score: 356.295 bits (913), Expect = 1.073e-97
Identity = 176/204 (86.27%), Postives = 190/204 (93.14%), Query Frame = 2
Query:  158 DWYDIKAPSCFRVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLGDLLNEEEHAYRKIRLRAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWHTLIEAYVDVKTTDNFTLRLFCIGFTKRLPNQVKRTCYAQTSQIRQIRRKMREIMVAQAASCDLKSLVEKFIAEVIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV 769
            DWYDIKAPS F  RNVGKTLVTRTQGTKIASEGLKHRVFEVSL DL N+E+H+YRKIRLRAEDVQGKNVLTNFWGM+ TTDKLRSLV+KW +LIEA+VDVKTTDNFTLR+FCIGFTK+  NQVKRTCYAQ+SQI+QIRRKMREIMV QA +CDLK LV+KFI E IGREIEKATSSIYPLQNVFIRKVKILKAPKFD+GKLMEV
Sbjct:   28 DWYDIKAPSLFITRNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQNDEDHSYRKIRLRAEDVQGKNVLTNFWGMDVTTDKLRSLVKKWQSLIEAHVDVKTTDNFTLRMFCIGFTKKRANQVKRTCYAQSSQIKQIRRKMREIMVTQAQTCDLKELVQKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDIGKLMEV 231          
BLAST of CK933032 vs. ExPASy Swiss-Prot
Match: RS3A_ORYSJ (40S ribosomal protein S3a OS=Oryza sativa subsp. japonica GN=RPS3A PE=2 SV=2)

HSP 1 Score: 355.14 bits (910), Expect = 2.390e-97
Identity = 176/204 (86.27%), Postives = 188/204 (92.16%), Query Frame = 2
Query:  158 DWYDIKAPSCFRVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLGDLLNEEEHAYRKIRLRAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWHTLIEAYVDVKTTDNFTLRLFCIGFTKRLPNQVKRTCYAQTSQIRQIRRKMREIMVAQAASCDLKSLVEKFIAEVIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV 769
            DWYDIKAPS F VRN+GKTLV+RTQGTKIASEGLKHRVFEVSL DL N+E+ AYRKIRLRAEDVQGKNVLTNFWGM+FTTDKLRSLV+KW TLIEA+VDVKTTD + LRLFCIGFTKR PNQVKRTCYAQ SQIRQIRRKM EIM  QA+SCDLK LV KFI EVIG+EIEKATSSI+PLQNVF+RKVKILKAPKFDLGKLMEV
Sbjct:   28 DWYDIKAPSVFNVRNIGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDQAYRKIRLRAEDVQGKNVLTNFWGMSFTTDKLRSLVKKWQTLIEAHVDVKTTDGYMLRLFCIGFTKRRPNQVKRTCYAQASQIRQIRRKMVEIMANQASSCDLKELVSKFIPEVIGKEIEKATSSIFPLQNVFVRKVKILKAPKFDLGKLMEV 231          
BLAST of CK933032 vs. ExPASy Swiss-Prot
Match: RS3A2_VITVI (40S ribosomal protein S3a-2 OS=Vitis vinifera GN=GSVIVT00031140001 PE=3 SV=1)

HSP 1 Score: 354.369 bits (908), Expect = 4.076e-97
Identity = 176/203 (86.70%), Postives = 188/203 (92.61%), Query Frame = 2
Query:  158 DWYDIKAPSCFRVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLGDLLNEEEHAYRKIRLRAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWHTLIEAYVDVKTTDNFTLRLFCIGFTKRLPNQVKRTCYAQTSQIRQIRRKMREIMVAQAASCDLKSLVEKFIAEVIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME 766
            DWYDIKAPS F VRNVGKTLV+RTQGTKIASEGLKHRVFE+SL DL N+E+HAYRKIRLRAEDVQGKNVLTNFWGM+FTTDKLRSLVRKW TLIEA+VDVKTTDN+TLR+FCI FTK+  NQ K+T YAQ+SQIRQIRRKMREIM  QAASCDLK LV KFI E+IGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME
Sbjct:   28 DWYDIKAPSIFSVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQNDEDHAYRKIRLRAEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIAFTKKRQNQNKKTSYAQSSQIRQIRRKMREIMTTQAASCDLKELVRKFIPEMIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLME 230          
BLAST of CK933032 vs. ExPASy Swiss-Prot
Match: RS3A_CICAR (40S ribosomal protein S3a OS=Cicer arietinum PE=2 SV=1)

HSP 1 Score: 353.599 bits (906), Expect = 6.953e-97
Identity = 175/204 (85.78%), Postives = 192/204 (94.12%), Query Frame = 2
Query:  158 DWYDIKAPSCFRVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLGDLLNEEEHAYRKIRLRAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWHTLIEAYVDVKTTDNFTLRLFCIGFTKRLPNQVKRTCYAQTSQIRQIRRKMREIMVAQAASCDLKSLVEKFIAEVIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV 769
            DWYDIKAPS F+V+NVGKTLV+RTQGTKIASEGLKHRVFE+SL DL  +E++A+RKIRLRAEDVQGKNVLTNF+GM+FTTDKLRSLVRKW TLIEA+VDVKTTDN+TLR+FCIGFTKR  NQVKRTCYAQ+SQIRQIRRKMREIMV QA SCDLK LV KFI E+IG+EIEKATSSIYPLQNVFIRKVKILK+PKFDLGKLMEV
Sbjct:   28 DWYDIKAPSVFQVKNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQGDEDNAFRKIRLRAEDVQGKNVLTNFYGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRMFCIGFTKRRSNQVKRTCYAQSSQIRQIRRKMREIMVNQATSCDLKELVRKFIPEMIGKEIEKATSSIYPLQNVFIRKVKILKSPKFDLGKLMEV 231          
BLAST of CK933032 vs. ExPASy Swiss-Prot
Match: RS3A_CATRO (40S ribosomal protein S3a OS=Catharanthus roseus GN=RPS3A PE=2 SV=4)

HSP 1 Score: 353.214 bits (905), Expect = 9.081e-97
Identity = 174/204 (85.29%), Postives = 190/204 (93.14%), Query Frame = 2
Query:  158 DWYDIKAPSCFRVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLGDLLNEEEHAYRKIRLRAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWHTLIEAYVDVKTTDNFTLRLFCIGFTKRLPNQVKRTCYAQTSQIRQIRRKMREIMVAQAASCDLKSLVEKFIAEVIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV 769
            DWYDIKAPS F VRNVGKTLVTRTQGTKIASEGL+HRVFE+SL DL  +E+H++RKIRLRAED+QGKNVLTNFWGM+FTTDKLRSLVRKW +LIEA+VDVKTTD++TLR+FCIGFTK+  NQ KRTCYAQ+SQIRQIRRKMREIMV QA SCDLK LV+KFI E IGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct:   28 DWYDIKAPSVFSVRNVGKTLVTRTQGTKIASEGLEHRVFEISLADLQGDEDHSFRKIRLRAEDIQGKNVLTNFWGMDFTTDKLRSLVRKWQSLIEAHVDVKTTDSYTLRMFCIGFTKKRANQQKRTCYAQSSQIRQIRRKMREIMVNQAQSCDLKDLVQKFIPESIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV 231          
BLAST of CK933032 vs. ExPASy Swiss-Prot
Match: RS3A1_VITVI (40S ribosomal protein S3a-1 OS=Vitis vinifera GN=GSVIVT00020038001 PE=3 SV=1)

HSP 1 Score: 347.051 bits (889), Expect = 6.508e-95
Identity = 173/204 (84.80%), Postives = 186/204 (91.18%), Query Frame = 2
Query:  158 DWYDIKAPSCFRVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLGDLLNEEEHAYRKIRLRAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWHTLIEAYVDVKTTDNFTLRLFCIGFTKRLPNQVKRTCYAQTSQIRQIRRKMREIMVAQAASCDLKSLVEKFIAEVIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV 769
            DWYDIKAPS F VRNVGKTLV+RTQGTKIASEGLKHRVFE+SL DL  +E+ AYRKIRLRAEDVQG+NVLTNFWGM+FTTDKLRSLVRKW TLIEA+VDVKTTDN+TLRLFCI FTK+  NQ K+TCYAQ+SQIRQIRRKMREIM   A SCDLK LV+KFI E IGREIEKATSSIYPLQNV+IRKVKILKAPKFDLGKLMEV
Sbjct:   28 DWYDIKAPSVFEVRNVGKTLVSRTQGTKIASEGLKHRVFEISLADLQADEDQAYRKIRLRAEDVQGRNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRLFCIAFTKKRVNQNKKTCYAQSSQIRQIRRKMREIMTNMATSCDLKELVKKFIPESIGREIEKATSSIYPLQNVYIRKVKILKAPKFDLGKLMEV 231          
BLAST of CK933032 vs. ExPASy Swiss-Prot
Match: RS3A2_ARATH (40S ribosomal protein S3a-2 OS=Arabidopsis thaliana GN=RPS3AB PE=2 SV=3)

HSP 1 Score: 343.584 bits (880), Expect = 7.195e-94
Identity = 170/204 (83.33%), Postives = 184/204 (90.20%), Query Frame = 2
Query:  158 DWYDIKAPSCFRVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLGDLLNEEEHAYRKIRLRAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWHTLIEAYVDVKTTDNFTLRLFCIGFTKRLPNQVKRTCYAQTSQIRQIRRKMREIMVAQAASCDLKSLVEKFIAEVIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV 769
            DWYD+KAP  F  RNVGKTLV+RTQGTKIASEGLKHRVFEVSL DL N+E++AYRKIRLRAEDVQG+NVLT FWGM+FTTDKLRSLV+KW TLIEA+VDVKTTD +TLR+FCI FTKR  NQVKRTCYAQ+SQIRQIRRKM EIMV +A+SCDLK LV KFI E IGREIEKAT  IYPLQNVFIRKVKILKAPKFDLGKLMEV
Sbjct:   28 DWYDVKAPGSFTNRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQNDEDNAYRKIRLRAEDVQGRNVLTQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDGYTLRMFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMSEIMVKEASSCDLKELVAKFIPEAIGREIEKATQGIYPLQNVFIRKVKILKAPKFDLGKLMEV 231          
BLAST of CK933032 vs. ExPASy Swiss-Prot
Match: RS3A_TOBAC (40S ribosomal protein S3a OS=Nicotiana tabacum GN=cyc07 PE=2 SV=1)

HSP 1 Score: 342.043 bits (876), Expect = 2.094e-93
Identity = 169/204 (82.84%), Postives = 187/204 (91.67%), Query Frame = 2
Query:  158 DWYDIKAPSCFRVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLGDLLNEEEHAYRKIRLRAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWHTLIEAYVDVKTTDNFTLRLFCIGFTKRLPNQVKRTCYAQTSQIRQIRRKMREIMVAQAASCDLKSLVEKFIAEVIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV 769
            DWYDIKAPS F ++NVGKTLVTRTQGTKIASEGLKHRVFEVSL DL  +E+ ++RKIRLRAEDVQGKNVLTNFWGM+FTTDKLRSLV+KW TLIEA+VDVKTTD++TLR+FCI FTK+ PNQ KRTCYAQ+SQIRQIRRKM EIM  QA+SCDLK LV KFI E IGREIEKATSSI+PLQNV+IRKVKILKAPKFD+GKLMEV
Sbjct:   28 DWYDIKAPSVFDIKNVGKTLVTRTQGTKIASEGLKHRVFEVSLADLQKDEDQSFRKIRLRAEDVQGKNVLTNFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRMFCIAFTKKRPNQQKRTCYAQSSQIRQIRRKMVEIMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVYIRKVKILKAPKFDIGKLMEV 231          
BLAST of CK933032 vs. ExPASy Swiss-Prot
Match: RS3A1_ARATH (40S ribosomal protein S3a-1 OS=Arabidopsis thaliana GN=RPS3AA PE=1 SV=3)

HSP 1 Score: 341.658 bits (875), Expect = 2.734e-93
Identity = 169/204 (82.84%), Postives = 185/204 (90.69%), Query Frame = 2
Query:  158 DWYDIKAPSCFRVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLGDLLNEEEHAYRKIRLRAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWHTLIEAYVDVKTTDNFTLRLFCIGFTKRLPNQVKRTCYAQTSQIRQIRRKMREIMVAQAASCDLKSLVEKFIAEVIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV 769
            DWYD+KAPS F  RNVGKTLV+RTQGTKIASEGLKHRVFEVSL DL  +E++AYRKIRLRAEDVQG+NVL  FWGM+FTTDKLRSLV+KW TLIEA+VDVKTTD++TLRLFCI FTKR  NQVKRTCYAQ+SQIRQIRRKMR+IMV +A+SCDLK LV KFI E IGREIEKAT  IYPLQNVFIRKVKILKAPKFDLGKLM+V
Sbjct:   28 DWYDVKAPSIFTHRNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDNAYRKIRLRAEDVQGRNVLCQFWGMDFTTDKLRSLVKKWQTLIEAHVDVKTTDSYTLRLFCIAFTKRRANQVKRTCYAQSSQIRQIRRKMRDIMVREASSCDLKDLVAKFIPEAIGREIEKATQGIYPLQNVFIRKVKILKAPKFDLGKLMDV 231          
BLAST of CK933032 vs. ExPASy Swiss-Prot
Match: RS3A_DAUCA (40S ribosomal protein S3a OS=Daucus carota GN=cyc07 PE=2 SV=1)

HSP 1 Score: 337.035 bits (863), Expect = 6.735e-92
Identity = 169/204 (82.84%), Postives = 186/204 (91.18%), Query Frame = 2
Query:  158 DWYDIKAPSCFRVRNVGKTLVTRTQGTKIASEGLKHRVFEVSLGDLLNEEEHAYRKIRLRAEDVQGKNVLTNFWGMNFTTDKLRSLVRKWHTLIEAYVDVKTTDNFTLRLFCIGFTKRLPNQVKRTCYAQTSQIRQIRRKMREIMVAQAASCDLKSLVEKFIAEVIGREIEKATSSIYPLQNVFIRKVKILKAPKFDLGKLMEV 769
            DWYDIKAP+ F+ +NVGKTLV+RTQGTKIASEGLKHRVFEV L DL  +E+ AYRKIRLRAEDVQGKNVLTNF+GM+FTTDKLRSLVRKW TLIEA+VDVKTTD++TLR+FCIGFTK+  NQ KRTCYAQ+SQIRQIRRKM EIM  QA+SCDLK LV KFI E IGREIEKATSSI+PLQNVFIRKVKILKAPKFD+GKLMEV
Sbjct:   28 DWYDIKAPNVFQNKNVGKTLVSRTQGTKIASEGLKHRVFEVCLADLQGDEDQAYRKIRLRAEDVQGKNVLTNFYGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDSYTLRMFCIGFTKKRANQQKRTCYAQSSQIRQIRRKMVEIMRNQASSCDLKELVAKFIPESIGREIEKATSSIFPLQNVFIRKVKILKAPKFDIGKLMEV 231          
The following BLAST results are available for this feature:
BLAST of CK933032 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 203
Match NameE-valueIdentityDescription
RS3A_HELAN1.073e-9786.2740S ribosomal protein S3a OS=Helianthus annuus GN=... [more]
RS3A_ORYSJ2.390e-9786.2740S ribosomal protein S3a OS=Oryza sativa subsp. j... [more]
RS3A2_VITVI4.076e-9786.7040S ribosomal protein S3a-2 OS=Vitis vinifera GN=G... [more]
RS3A_CICAR6.953e-9785.7840S ribosomal protein S3a OS=Cicer arietinum PE=2 ... [more]
RS3A_CATRO9.081e-9785.2940S ribosomal protein S3a OS=Catharanthus roseus G... [more]
RS3A1_VITVI6.508e-9584.8040S ribosomal protein S3a-1 OS=Vitis vinifera GN=G... [more]
RS3A2_ARATH7.195e-9483.3340S ribosomal protein S3a-2 OS=Arabidopsis thalian... [more]
RS3A_TOBAC2.094e-9382.8440S ribosomal protein S3a OS=Nicotiana tabacum GN=... [more]
RS3A1_ARATH2.734e-9382.8440S ribosomal protein S3a-1 OS=Arabidopsis thalian... [more]
RS3A_DAUCA6.735e-9282.8440S ribosomal protein S3a OS=Daucus carota GN=cyc0... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit juice sac at 38 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004348_D12 Developing fruit juice sac at 38 DAFB Citrus sinensis cDNA clone JSJune0004_IIF_D12 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933032 ID=CK933032|Name=CK933032|organism=Citrus sinensis|type=EST|length=770bp
GGGGCTCTTCACTCACAATGAACGAGCTAGGACTAGGTAGCAGCGGAGCC
GTCTCTTGAGCAGCAGCTGCACAAACATGGCTGTCGGGAAGAACAAGAGG
ATTTCAAAGGGGAAGAAAGGAGGCAAGAAGAAGGCTGCTGATCCGTTTGC
CAAGAAGGACTGGTATGATATCAAGGCTCCATCTTGTTTCCGCGTCAGAA
ATGTTGGCAAGACTCTTGTTACCCGGACTCAGGGTACCAAGATTGCATCA
GAAGGTCTCAAGCACAGAGTGTTTGAGGTATCACTAGGTGATCTTCTCAA
TGAAGAAGAGCATGCTTACAGGAAGATCAGACTGAGAGCTGAAGATGTCC
AAGGGAAGAATGTTTTGACTAACTTCTGGGGCATGAATTTCACTACAGAC
AAGCTGAGGTCTTTGGTTAGGAAGTGGCATACCTTGATTGAAGCTTACGT
GGATGTCAAGACCACTGATAACTTCACATTGAGGTTGTTCTGCATTGGAT
TCACCAAGAGACTTCCAAACCAGGTTAAGAGGACTTGCTACGCACAGACC
AGCCAGATTAGACAGATTCGCCGCAAGATGAGGGAGATCATGGTTGCTCA
GGCAGCATCTTGTGATCTTAAGAGCTTGGTCGAAAAGTTCATTGCTGAAG
TGATTGGAAGAGAGATTGAGAAGGCAACGTCAAGCATATACCCCTTACAA
AATGTGTTCATTCGCAAAGTGAAGATCCTGAAAGCTCCCAAGTTTGATCT
TGGAAAATTGATGGAGGTTC
back to top