CK933035

Overview
NameCK933035
Unique NameCK933035
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length780
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3163 contig Csv1_Contig3163:69..848. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK933035 vs. ExPASy Swiss-Prot
Match: CYSK_CITLA (Cysteine synthase OS=Citrullus lanatus PE=2 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 8.071e-77
Identity = 141/204 (69.12%), Postives = 166/204 (81.37%), Query Frame = 2
Query:  161 KCEIKKDVTELIGHTPMVYLNNVVDGCVARIAAKLEMMQPCSSVKDRIAYSMIKDAEDKGLITPGKTVLIELTSGNTGIGLAFIAASRGYKLIIIMPSTYSIERRIILRALGAEVYLADPAVGFEGFVKKGEEILNRTPNGYILGQFENPANPEIYYETTGPEIWNDSGGKVDAFXXXXXXXXXXXXXXRFLKEKNPNIKVYGI 772
            K  I KDVTELIG+TP+VYLN VVDGCVAR+AAKLEMM+PCSSVKDRI YSMI DAE+KGLITPG++VLIE TSGNTGIGLAFIAA++GY+LII MP++ S+ERR ILRA GAE+ L DPA G +G V+K EEI  +TPN YIL QFENPANP+I+YETTGPEIW  SGGK+DA               ++LKE+NPNIK+YG+
Sbjct:    5 KSTIAKDVTELIGNTPLVYLNRVVDGCVARVAAKLEMMEPCSSVKDRIGYSMISDAENKGLITPGESVLIEPTSGNTGIGLAFIAAAKGYRLIICMPASMSLERRTILRAFGAELVLTDPARGMKGAVQKAEEIKAKTPNSYILQQFENPANPKIHYETTGPEIWRGSGGKIDALVSGIGTGGTVTGAGKYLKEQNPNIKLYGV 208          
BLAST of CK933035 vs. ExPASy Swiss-Prot
Match: CYSK_SOLTU (Cysteine synthase OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 278.1 bits (710), Expect = 3.749e-74
Identity = 135/205 (65.85%), Postives = 163/205 (79.51%), Query Frame = 2
Query:  158 DKCEIKKDVTELIGHTPMVYLNNVVDGCVARIAAKLEMMQPCSSVKDRIAYSMIKDAEDKGLITPGKTVLIELTSGNTGIGLAFIAASRGYKLIIIMPSTYSIERRIILRALGAEVYLADPAVGFEGFVKKGEEILNRTPNGYILGQFENPANPEIYYETTGPEIWNDSGGKVDAFXXXXXXXXXXXXXXRFLKEKNPNIKVYGI 772
            +K  I KDVTELIG+TP+VYLNNVVDGCVAR+AAKLE M+PCSSVKDRI YSMI DAE+KGLI PG++VLIE TSGNTG+GLAF+AA++GYKLII MPS+ S+ERRIILR   +E+ L DPA G +G + K EEI  +TPN YIL QFENPANP+I+YETTGPEIW  S GKVDA               ++L+E+NPN+K+YG+
Sbjct:    4 EKIGIAKDVTELIGNTPLVYLNNVVDGCVARVAAKLESMEPCSSVKDRIGYSMITDAEEKGLIKPGESVLIEPTSGNTGVGLAFMAAAKGYKLIITMPSSMSLERRIILRGFRSELVLTDPAKGMKGAISKAEEIKAKTPNSYILQQFENPANPKIHYETTGPEIWKGSNGKVDALASGIGTGGTITGSGKYLREQNPNVKLYGV 208          
BLAST of CK933035 vs. ExPASy Swiss-Prot
Match: CYSKP_CAPAN (Cysteine synthase, chloroplastic/chromoplastic OS=Capsicum annuum PE=2 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 4.896e-74
Identity = 134/201 (66.67%), Postives = 161/201 (80.10%), Query Frame = 2
Query:  170 IKKDVTELIGHTPMVYLNNVVDGCVARIAAKLEMMQPCSSVKDRIAYSMIKDAEDKGLITPGKTVLIELTSGNTGIGLAFIAASRGYKLIIIMPSTYSIERRIILRALGAEVYLADPAVGFEGFVKKGEEILNRTPNGYILGQFENPANPEIYYETTGPEIWNDSGGKVDAFXXXXXXXXXXXXXXRFLKEKNPNIKVYGI 772
            I +DVT+LIG+TPMVYLN +V GCVA IAAKLE+M+PC SVKDRI +SMI DAE+KGLI+PGKTVL+E TSGNTGIGLAFIAASRGYKLI+ MP++ S+ERR+IL+A GAE+ L DPA G +G V K EEILN TP+ YIL QF+NPANP+I+YETTGPEIW D+ GK+D                R+LKEKNPNIK+ G+
Sbjct:   67 IAEDVTQLIGNTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMISDAEEKGLISPGKTVLVEPTSGNTGIGLAFIAASRGYKLILTMPASMSLERRVILKAFGAELVLTDPAKGMKGAVSKAEEILNNTPDAYILQQFDNPANPKIHYETTGPEIWEDTKGKIDILVAGIGTGGTISGTGRYLKEKNPNIKIIGV 267          
BLAST of CK933035 vs. ExPASy Swiss-Prot
Match: CYSK_SPIOL (Cysteine synthase OS=Spinacia oleracea PE=1 SV=1)

HSP 1 Score: 275.404 bits (703), Expect = 2.430e-73
Identity = 134/207 (64.73%), Postives = 164/207 (79.23%), Query Frame = 2
Query:  152 MEDKCEIKKDVTELIGHTPMVYLNNVVDGCVARIAAKLEMMQPCSSVKDRIAYSMIKDAEDKGLITPGKTVLIELTSGNTGIGLAFIAASRGYKLIIIMPSTYSIERRIILRALGAEVYLADPAVGFEGFVKKGEEILNRTPNGYILGQFENPANPEIYYETTGPEIWNDSGGKVDAFXXXXXXXXXXXXXXRFLKEKNPNIKVYGI 772
            +E+K  I KDVTELIG TP+VYLN V DGCVAR+AAKLE M+PCSSVKDRI +SMI DAE  GLITPG++VLIE TSGNTGIGLAFIAA++GYKLII MP++ S+ERR ILRA GAE+ L DPA G +G V+K EEI ++TPN YIL QFENPANP+++YETTGPEIW  +GGK+D F              ++LKE+NP++K+ G+
Sbjct:    2 VEEKAFIAKDVTELIGKTPLVYLNTVADGCVARVAAKLEGMEPCSSVKDRIGFSMITDAEKSGLITPGESVLIEPTSGNTGIGLAFIAAAKGYKLIITMPASMSLERRTILRAFGAELILTDPAKGMKGAVQKAEEIRDKTPNSYILQQFENPANPKVHYETTGPEIWKGTGGKIDIFVSGIGTGGTITGAGKYLKEQNPDVKLIGL 208          
BLAST of CK933035 vs. ExPASy Swiss-Prot
Match: CYSK1_BRAJU (Cysteine synthase OS=Brassica juncea PE=2 SV=1)

HSP 1 Score: 275.404 bits (703), Expect = 2.430e-73
Identity = 131/201 (65.17%), Postives = 160/201 (79.60%), Query Frame = 2
Query:  170 IKKDVTELIGHTPMVYLNNVVDGCVARIAAKLEMMQPCSSVKDRIAYSMIKDAEDKGLITPGKTVLIELTSGNTGIGLAFIAASRGYKLIIIMPSTYSIERRIILRALGAEVYLADPAVGFEGFVKKGEEILNRTPNGYILGQFENPANPEIYYETTGPEIWNDSGGKVDAFXXXXXXXXXXXXXXRFLKEKNPNIKVYGI 772
            I KDVTELIG+TP+VYLNNV +GCV R+AAKLEMM+PCSSVKDRI +SMI DAE KGLI PG++VLIE TSGNTG+GLAF AA++GYKLII MP++ S+ERRIIL A G E+ L DPA G +G + K EEIL +TPNGY+L QFENPANP+I+YETTGPEIW  + GK+D F              ++LKE+NPN+K+YG+
Sbjct:    5 IAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEQKGLIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSVERRIILLAFGVELVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTDGKIDGFVSGIGTGGTITGAGKYLKEQNPNVKLYGV 205          
BLAST of CK933035 vs. ExPASy Swiss-Prot
Match: CYSKP_SOLTU (Cysteine synthase, chloroplastic/chromoplastic OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 3.174e-73
Identity = 133/201 (66.17%), Postives = 160/201 (79.60%), Query Frame = 2
Query:  170 IKKDVTELIGHTPMVYLNNVVDGCVARIAAKLEMMQPCSSVKDRIAYSMIKDAEDKGLITPGKTVLIELTSGNTGIGLAFIAASRGYKLIIIMPSTYSIERRIILRALGAEVYLADPAVGFEGFVKKGEEILNRTPNGYILGQFENPANPEIYYETTGPEIWNDSGGKVDAFXXXXXXXXXXXXXXRFLKEKNPNIKVYGI 772
            I +DVT+LIG+TPMVYLN +  GCVA IAAKLE+M+PC SVKDRI +SMI DAE+KGLI+PGKTVL+E TSGNTGIGLAFIAASRGYKLI+ MP++ S+ERR+IL+A GAE+ L DPA G +G V K EEILN TP+ YIL QF+NPANP+I+YETTGPEIW D+ GK+D                RFLKE+NPNIK+ G+
Sbjct:   69 IAEDVTQLIGNTPMVYLNTIAKGCVANIAAKLEIMEPCCSVKDRIGFSMIVDAEEKGLISPGKTVLVEPTSGNTGIGLAFIAASRGYKLILTMPASMSLERRVILKAFGAELVLTDPAKGMKGAVSKAEEILNNTPDAYILQQFDNPANPKIHYETTGPEIWEDTKGKIDILVAGIGTGGTITGTGRFLKEQNPNIKIIGV 269          
BLAST of CK933035 vs. ExPASy Swiss-Prot
Match: CYSK1_ARATH (Cysteine synthase OS=Arabidopsis thaliana GN=OASA1 PE=1 SV=2)

HSP 1 Score: 273.092 bits (697), Expect = 1.206e-72
Identity = 131/201 (65.17%), Postives = 159/201 (79.10%), Query Frame = 2
Query:  170 IKKDVTELIGHTPMVYLNNVVDGCVARIAAKLEMMQPCSSVKDRIAYSMIKDAEDKGLITPGKTVLIELTSGNTGIGLAFIAASRGYKLIIIMPSTYSIERRIILRALGAEVYLADPAVGFEGFVKKGEEILNRTPNGYILGQFENPANPEIYYETTGPEIWNDSGGKVDAFXXXXXXXXXXXXXXRFLKEKNPNIKVYGI 772
            I KDVTELIG+TP+VYLNNV +GCV R+AAKLEMM+PCSSVKDRI +SMI DAE KGLI PG++VLIE TSGNTG+GLAF AA++GYKLII MP++ S ERRIIL A G E+ L DPA G +G + K EEIL +TPNGY+L QFENPANP+I+YETTGPEIW  +GGK+D F              ++LKE+N N+K+YG+
Sbjct:    5 IAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGLIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGKIDGFVSGIGTGGTITGAGKYLKEQNANVKLYGV 205          
BLAST of CK933035 vs. ExPASy Swiss-Prot
Match: CYSK2_BRAJU (Cysteine synthase OS=Brassica juncea PE=2 SV=1)

HSP 1 Score: 272.322 bits (695), Expect = 2.057e-72
Identity = 131/207 (63.29%), Postives = 161/207 (77.78%), Query Frame = 2
Query:  152 MEDKCEIKKDVTELIGHTPMVYLNNVVDGCVARIAAKLEMMQPCSSVKDRIAYSMIKDAEDKGLITPGKTVLIELTSGNTGIGLAFIAASRGYKLIIIMPSTYSIERRIILRALGAEVYLADPAVGFEGFVKKGEEILNRTPNGYILGQFENPANPEIYYETTGPEIWNDSGGKVDAFXXXXXXXXXXXXXXRFLKEKNPNIKVYGI 772
            M  +  I  DVTELIG+TP+VYLN+V +GCV R+AAKLEMM+PCSSVKDRI +SMI DAE KGLI PG++VLIE TSGNTG+GLAF AA++GYKLII MP++ SIERRIIL A G E+ L DPA G +G + K EEIL +TPNGY+L QFENPANP+I+YETTGPEIW  + GK+D F              ++LKE+NPN+K+YG+
Sbjct:    1 MASRIGIANDVTELIGNTPLVYLNSVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGLIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSIERRIILLAFGVELVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTEGKIDGFISGIGTGGTITGAGKYLKEQNPNVKLYGV 207          
BLAST of CK933035 vs. ExPASy Swiss-Prot
Match: CYSK1_ORYSJ (Cysteine synthase OS=Oryza sativa subsp. japonica GN=RCS1 PE=2 SV=2)

HSP 1 Score: 270.781 bits (691), Expect = 5.986e-72
Identity = 129/201 (64.18%), Postives = 161/201 (80.10%), Query Frame = 2
Query:  170 IKKDVTELIGHTPMVYLNNVVDGCVARIAAKLEMMQPCSSVKDRIAYSMIKDAEDKGLITPGKTVLIELTSGNTGIGLAFIAASRGYKLIIIMPSTYSIERRIILRALGAEVYLADPAVGFEGFVKKGEEILNRTPNGYILGQFENPANPEIYYETTGPEIWNDSGGKVDAFXXXXXXXXXXXXXXRFLKEKNPNIKVYGI 772
            I KDVTELIG+TP+VYLN V DGCV R+AAKLE M+PCSSVKDRI YSMI DAE+KGLITPGK+VLIE TSGNTGIGLAF+AA++GY+L++ MP++ S+ERRIIL+A GAE+ L DP +G +G V+K EE+  +T N +IL QFENPANP+I+YETTGPEIW  +GGKVD                R+L+E+NP+IK+YG+
Sbjct:    5 IAKDVTELIGNTPLVYLNRVTDGCVGRVAAKLESMEPCSSVKDRIGYSMITDAEEKGLITPGKSVLIEPTSGNTGIGLAFMAAAKGYRLVLTMPASMSMERRIILKAFGAELILTDPLLGMKGAVQKAEELAAKTNNSFILQQFENPANPKIHYETTGPEIWKGTGGKVDGLVSGIGTGGTITGAGRYLREQNPDIKIYGV 205          
BLAST of CK933035 vs. ExPASy Swiss-Prot
Match: CYSK_WHEAT (Cysteine synthase OS=Triticum aestivum GN=CYS1 PE=2 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 2.971e-71
Identity = 127/201 (63.18%), Postives = 159/201 (79.10%), Query Frame = 2
Query:  170 IKKDVTELIGHTPMVYLNNVVDGCVARIAAKLEMMQPCSSVKDRIAYSMIKDAEDKGLITPGKTVLIELTSGNTGIGLAFIAASRGYKLIIIMPSTYSIERRIILRALGAEVYLADPAVGFEGFVKKGEEILNRTPNGYILGQFENPANPEIYYETTGPEIWNDSGGKVDAFXXXXXXXXXXXXXXRFLKEKNPNIKVYGI 772
            I KDVTELIG+TP+VYLN V DGCV R+AAKLE M+PCSSVKDRI YSMI DAE+KG I PGK+VLIE TSGNTGIGLAF+AA++GY+L++ MP++ S+ERRIIL+A GAE+ L DP +G +G V+K EE+  +TPN YIL QFEN ANP+I+YETTGPEIW  +GGK+D                ++L+E+NPNIK+YG+
Sbjct:    9 IAKDVTELIGNTPLVYLNKVTDGCVGRVAAKLESMEPCSSVKDRIGYSMITDAEEKGFIVPGKSVLIEPTSGNTGIGLAFMAAAKGYRLVLTMPASMSMERRIILKAFGAELILTDPLLGMKGAVQKAEELAAKTPNSYILQQFENAANPKIHYETTGPEIWKGTGGKIDGLVSGIGTGGTITGTGKYLQEQNPNIKLYGV 209          
The following BLAST results are available for this feature:
BLAST of CK933035 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 66
Match NameE-valueIdentityDescription
CYSK_CITLA8.071e-7769.12Cysteine synthase OS=Citrullus lanatus PE=2 SV=1[more]
CYSK_SOLTU3.749e-7465.85Cysteine synthase OS=Solanum tuberosum PE=2 SV=1[more]
CYSKP_CAPAN4.896e-7466.67Cysteine synthase, chloroplastic/chromoplastic OS=... [more]
CYSK_SPIOL2.430e-7364.73Cysteine synthase OS=Spinacia oleracea PE=1 SV=1[more]
CYSK1_BRAJU2.430e-7365.17Cysteine synthase OS=Brassica juncea PE=2 SV=1[more]
CYSKP_SOLTU3.174e-7366.17Cysteine synthase, chloroplastic/chromoplastic OS=... [more]
CYSK1_ARATH1.206e-7265.17Cysteine synthase OS=Arabidopsis thaliana GN=OASA1... [more]
CYSK2_BRAJU2.057e-7263.29Cysteine synthase OS=Brassica juncea PE=2 SV=1[more]
CYSK1_ORYSJ5.986e-7264.18Cysteine synthase OS=Oryza sativa subsp. japonica ... [more]
CYSK_WHEAT2.971e-7163.18Cysteine synthase OS=Triticum aestivum GN=CYS1 PE=... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit juice sac at 38 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004348_E03 Developing fruit juice sac at 38 DAFB Citrus sinensis cDNA clone JSJune0004_IIF_E03 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK933035 ID=CK933035|Name=CK933035|organism=Citrus sinensis|type=EST|length=780bp
GGGGGTGGATATGTATATATGTTTATCTTCAATGTCTGATGCATAATGTA
TTTCAGAGAAAAAATTACACCAGGAACTGGTATCTCCATTCAAACTGCCA
AGTGCTAGGCTGGCTGCTTGATTTTTTGAAAGTTTTTGGTGAAGTAGCTC
CATGGAGGACAAGTGTGAAATTAAGAAAGACGTTACGGAATTAATAGGCC
ATACACCGATGGTGTATCTCAATAATGTTGTGGATGGTTGTGTCGCCCGT
ATTGCTGCCAAGCTAGAAATGATGCAACCTTGCTCTAGCGTCAAAGACAG
AATTGCATATAGTATGATCAAAGATGCAGAGGATAAGGGCTTAATAACCC
CAGGGAAGACTGTCCTCATTGAGCTAACTAGTGGAAACACCGGCATTGGA
TTGGCCTTCATTGCAGCATCAAGGGGTTACAAACTTATCATTATAATGCC
ATCAACATACAGTATTGAGAGAAGAATAATTCTCAGAGCTTTGGGAGCTG
AGGTTTATCTTGCAGATCCAGCAGTGGGCTTTGAGGGGTTTGTTAAAAAG
GGTGAGGAGATACTAAACAGAACACCTAATGGTTATATTCTTGGACAATT
TGAAAATCCCGCGAATCCGGAGATTTATTACGAGACAACTGGCCCAGAGA
TATGGAACGACTCAGGAGGGAAGGTTGATGCTTTTATAGCAGGGATAGGA
ACTGGTGGTACTGTAACTGGTGCGGGGAGATTCCTTAAAGAAAAGAACCC
AAATATTAAGGTATATGGTATANNNNNATC
back to top