CK934428

Overview
NameCK934428
Unique NameCK934428
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length862
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CK934428_ssr342 microsatellite CK934428_ssr342:342..359. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig7942 contig Csv1_Contig7942:73..933. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK934428 vs. ExPASy Swiss-Prot
Match: CRTZ_ESCVU (Beta-carotene hydroxylase OS=Escherichia vulneris GN=crtZ PE=4 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.227e-15
Identity = 43/95 (45.26%), Postives = 60/95 (63.16%), Query Frame = 1
Query:  574 AAVGMEFWARWAHKALWHASLWHMHESHHRPREGPFELNDVFAIINAVPAIALLSFGFFHKGLVPGLCFGAGLGITVFGMAYMFVHXGLVHKRFP 858
            + + ME  A + H+ + H   W  HESHH PR+G FELND+FA++ A  AIAL++ G    G+ P    G G+  TV+G+ Y  VH GLVH+R+P
Sbjct:   11 SVIAMEGIAAFTHRYIMHGWGWRWHESHHTPRKGVFELNDLFAVVFAGVAIALIAVG--TAGVWPLQWIGCGM--TVYGLLYFLVHDGLVHQRWP 101          
BLAST of CK934428 vs. ExPASy Swiss-Prot
Match: CRTZ_PANAN (Beta-carotene hydroxylase OS=Pantoea ananas GN=crtZ PE=4 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.357e-14
Identity = 41/93 (44.09%), Postives = 57/93 (61.29%), Query Frame = 1
Query:  580 VGMEFWARWAHKALWHASLWHMHESHHRPREGPFELNDVFAIINAVPAIALLSFGFFHKGLVPGLCFGAGLGITVFGMAYMFVHXGLVHKRFP 858
            +GME  A  AHK + H   W  H SHH PR+G FE+ND++A++ A  +I L+  G    G+ P    GAG+  T +G+ Y  VH GLVH+R+P
Sbjct:   15 IGMEVIAALAHKYIMHGWGWGWHLSHHEPRKGAFEVNDLYAVVFAALSILLIYLG--STGMWPLQWIGAGM--TAYGLLYFMVHDGLVHQRWP 103          
The following BLAST results are available for this feature:
BLAST of CK934428 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
CRTZ_ESCVU1.227e-1545.26Beta-carotene hydroxylase OS=Escherichia vulneris ... [more]
CRTZ_PANAN1.357e-1444.09Beta-carotene hydroxylase OS=Pantoea ananas GN=crt... [more]
back to top
Properties
Property NameValue
Genbank descriptionCGF1004259_C07 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10004_IIF_C07 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK934428 ID=CK934428|Name=CK934428|organism=Citrus sinensis|type=EST|length=862bp
GCGGGACGCTCACGCCATTAAACACCACAATNNNCAATCCACTTCACATC
AACTCTTCCTCTTTTCAAGTGCTTTTACTCTAAAACCCAAAACTTCGTAA
ACAAACAAAACCCCACCATGGCGGTCGGACTATTGGCCGCCATAGTCCCG
AAGCCCTTCTGTCTCCTCACAACAAAACTTCAACCCTCTTCGCTCCTCAC
AACAAAACCCGCTCCCCTTTTTGCCCCTCTCGGTACCCGCCACGGCTTCT
TTAATGGCAAAAACCGAAGAAAAATCAACTCTTTCACCGTATGTTTTGTT
TTAGAGGAGAAAAAACAAAGCACCCAGATCGAGACTTTCACGGAGGAGGA
GGAGGAGGAGTCGGGTACCCAGATCTCGACTGCTGCCCGCGTGGCCGAGA
AATTGGCGAGAAAGAGATCCGAGAGGTTCACTTATCTCGTTGCTGCCGTC
ATGTCTAGTTTTGGTATCACTTCCATGGCTGTCATGGCTGTTTATTACAG
GTTCTGGTGGCAAATGGAGGGTGGAGAGGTGCCTTTAGCTGAAATGTTTG
GCACATTTGCTCTCTCTGTTGGTGCTGCTGTGGGCATGGAGTTTTGGGCA
CGATGGGCTCATAAAGCTCTGTGGCATGCTTCTTTATGGCATATGCACGA
GTCTCACCATCGACCAAGAGAGGGTCCTTTTGAGCTAAACGATGTGTTTG
CCATAATCAACGCAGTTCCAGCCATAGCCCTTCTCTCTTTTGGCTTCTTC
CACAAAGGCCTTGTACCTGGTCTCTGTTTTGGTGCTGGACTTGGCATTAC
GGTGTTTGGGATGGCCTACATGTTCGTCCACNNNGGTCTCGTTCACAAAA
GGTTCCCTGTGG
back to top