CK934434

Overview
NameCK934434
Unique NameCK934434
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length763
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10852 contig Csv1_Contig10852:1..755. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK934434 vs. ExPASy Swiss-Prot
Match: ASP_THECC (21 kDa seed protein OS=Theobroma cacao GN=ASP PE=2 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 1.598e-29
Identity = 75/197 (38.07%), Postives = 111/197 (56.35%), Query Frame = 3
Query:   57 TAISFLLLTFSTKP-LVGLAD----PLVDVHGNKVEASRDYYLVSAIXXXXXXXXXXXXXXNELCPLDVVQLSSDSKRGTRLRFSMHD-KTSIINEDVDLNVRFST--ETRCNEPTVWRVDSYDPSRGKWFITTGGVEGNPGAQTLKNWFKFERIGRDRAMYKIVHCPSVCESCVSLCNDVG--VSNDHARRLALTN 617
            TA+  LL  F++K    G+A+    P++D  G++++    YY++S+I               + CP  VVQ  SD   GT + FS  D K  ++    D+N+ F    +  C+  TVWR+D+YD S GKW++TT GV+G PG  TL +WFK E+ G     YK   CPSVC+SC +LC+D+G    +D   RLAL++
Sbjct:    5 TAVVLLLFAFTSKSYFFGVANAANSPVLDTDGDELQTGVQYYVLSSISGAGGGGLALGRATGQSCPEIVVQRRSDLDNGTPVIFSNADSKDDVVRVSTDVNIEFVPIRDRLCSTSTVWRLDNYDNSAGKWWVTTDGVKGEPGPNTLCSWFKIEKAG--VLGYKFRFCPSVCDSCTTLCSDIGRHSDDDGQIRLALSD 199          
BLAST of CK934434 vs. ExPASy Swiss-Prot
Match: MIRA_RICDU (Miraculin OS=Richadella dulcifica PE=1 SV=3)

HSP 1 Score: 119.783 bits (299), Expect = 1.654e-26
Identity = 70/192 (36.46%), Postives = 98/192 (51.04%), Query Frame = 3
Query:   75 LLTFSTKPLVGLAD----PLVDVHGNKVEASRDYYLVSAIXXXXXXXXXXXXXXNE--LCPLDVVQLSSDSKRGTRLRFSMHD-KTSIINEDVDLNVRFSTETRCN--EPTVWRVDSYDPSRGKWFITTGGVEGNPGAQTLKNWFKFERIGRDRAMYKIVHCPSVCESCVSLCNDVGVSNDH--ARRLALTN 617
            LL  +  PL+  AD    P++D+ G K+    +YY+V  +              N   +CP  VVQ   +      L F   + K  ++    DLN+ FS    C     TVWR+D YD S G++F+T GGV+GNPG +T+ +WFK E        YK+V CP+VC SC   C DVG+  D    RRLAL++
Sbjct:   17 LLAAAANPLLSAADSAPNPVLDIDGEKLRTGTNYYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFPENPKEDVVRVSTDLNINFSAFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEF-CGSGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSD 207          
BLAST of CK934434 vs. ExPASy Swiss-Prot
Match: LSPI_CARPA (Latex serine proteinase inhibitor OS=Carica papaya PE=1 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.833e-17
Identity = 60/170 (35.29%), Postives = 85/170 (50.00%), Query Frame = 3
Query:  117 PLVDVHGNKVEASRDYYLVSAIXXXXXXXXXXXXXXNEL-CPLDVVQLSSDSKRGTRLRFSMHDKTSIINEDVDLNVRFSTETRCNEPTVWRVDSYDPSRGKWFITTGGVEGNPGAQTLKNWFKFERIGRDRAMYKIVHCPSVCESCVSLCNDVGVSND--HARRLALTN 617
            P+VD+ G  V    DY++VSAI              N+  CPL VVQ   D+          + K +I+ E VDLNV+F+    CNE T W+VD + P    W +T GG +G  G ++  + FK ++ G   + YK   CPS   + +  CN+V +  D    RRL LTN
Sbjct:    5 PIVDIDGKPVLYGVDYFVVSAIWGAGGGGLTVYGPGNKKKCPLSVVQDPFDNGEPIIFSAIKNVKDNIVFESVDLNVKFNITINCNETTAWKVDRF-PGVIGWTVTLGGEKGYHGFESTHSMFKIKKAGLPFS-YKFHFCPSYPRTRLIPCNNVDIFFDKYRIRRLILTN 172          
BLAST of CK934434 vs. ExPASy Swiss-Prot
Match: DRTI_DELRE (Kunitz-type serine protease inhibitor DrTI OS=Delonix regia PE=1 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 4.226e-14
Identity = 47/168 (27.98%), Postives = 82/168 (48.81%), Query Frame = 3
Query:  111 ADPLVDVHGNKVEASRDYYLVSAIXXXXXXXXXXXXXXNELCPLDVVQLSSDSKRGTRLRFSMHDKT-SIINEDVDLNVRFSTETRCNEPTVWRVDSYDPSRGKWFITTGGVEGNPGAQTLKNWFKFERIGRDRAMYKIVHCPSVCESCVSLCNDVGVSNDHARRLAL 611
            A+ + D+ G  V    +YY+VSAI                +CP+ ++Q  SD + G  +RFS  +++   I  D +L + F  +  C E + W +       G+  +  GG E +P  + ++ +FK E++G     YK+V CP   +S    C+D+G++ +  R L L
Sbjct:    3 AEKVYDIEGYPVFLGSEYYIVSAIIGAGGGGVRPGRTRGSMCPMSIIQEQSDLQMGLPVRFSSPEESQGKIYTDTELEIEFVEKPDCAESSKWVIVK---DSGEARVAIGGSEDHPQGELVRGFFKIEKLG--SLAYKLVFCP---KSSSGSCSDIGINYEGRRSLVL 162          
BLAST of CK934434 vs. ExPASy Swiss-Prot
Match: SPI2_SOLTU (Serine protease inhibitor 2 OS=Solanum tuberosum PE=1 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 4.373e-11
Identity = 55/185 (29.73%), Postives = 84/185 (45.41%), Query Frame = 3
Query:  111 ADPLVDVHGNKVEASRDYYLVSAIXXXXXXXXXXXXXXNELCPL--DVVQLSSD-SKRGTRLRF---SMHDKTSIINEDVDLNVRF--STETRCNEPTVWRVDSYDPSRGKWFITTGGVEGNPGAQTLKNWFKFERIGRDRAMYKIVHCPSVCESCVSLCNDVGVSNDHA-RRLALTNGRALAVV 638
            A P++DV G ++++   Y ++S                N   P    + + +SD    GT +RF   S H    I   ++ LN++F  ST   C   T+W+V  YD S G   + TGG  G    Q   +WFK   +   +  Y +++CP    S    C+ VGV + +  RRLAL N   L V+
Sbjct:    5 ATPVLDVTGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENEL-LNIQFAISTSKLCVSYTIWKVGDYDASLGTMLLETGGTIG----QADSSWFKI--VKSSQLGYNLLYCPVTSSSDDQFCSKVGVVHQNGKRRLALVNENPLDVL 182          
The following BLAST results are available for this feature:
BLAST of CK934434 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
ASP_THECC1.598e-2938.0721 kDa seed protein OS=Theobroma cacao GN=ASP PE=2... [more]
MIRA_RICDU1.654e-2636.46Miraculin OS=Richadella dulcifica PE=1 SV=3[more]
LSPI_CARPA1.833e-1735.29Latex serine proteinase inhibitor OS=Carica papaya... [more]
DRTI_DELRE4.226e-1427.98Kunitz-type serine protease inhibitor DrTI OS=Delo... [more]
SPI2_SOLTU4.373e-1129.73Serine protease inhibitor 2 OS=Solanum tuberosum P... [more]
back to top
Properties
Property NameValue
Genbank descriptionCGF1004259_B03 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10004_IIF_B03 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK934434 ID=CK934434|Name=CK934434|organism=Citrus sinensis|type=EST|length=763bp
GGGGAACTCACTCAATCAGCTCTCTGAAAGATAACAAAATGAGTACTCCT
TTTGTAACTGCAATCTCCTTCCTTCTCCTTACCTTTTCCACAAAACCGCT
TGTGGGACTCGCTGATCCTTTGGTTGATGTCCATGGCAACAAGGTCGAAG
CATCCCGAGACTACTATTTGGTCTCAGCAATTCGAGGAGCAGGCGGTGGC
GGCCTCACCCTCTTCAGGGGCAGAAACGAACTCTGCCCACTTGATGTTGT
CCAACTAAGTTCCGACTCAAAAAGAGGAACCCGTTTAAGATTCTCAATGC
ATGATAAAACTAGTATTATCAATGAAGATGTGGATCTGAACGTGAGATTC
TCCACAGAGACTCGCTGCAACGAACCAACAGTATGGAGAGTCGACAGCTA
TGATCCATCGAGAGGAAAATGGTTTATAACAACTGGTGGTGTTGAAGGAA
ACCCTGGAGCTCAAACTTTGAAAAACTGGTTTAAGTTTGAGAGAATTGGA
AGAGATCGAGCTATGTACAAGATTGTTCACTGTCCTTCCGTTTGCGAATC
CTGTGTATCTTTATGCAATGATGTTGGGGTTTCTAACGATCATGCTCGAC
GTTTGGCTCTCACTAATGGGCGCGCGCTTGCTGTTGTTCTAGTCCCTGGT
AACGAGAGATCAGCCTCATGTGCGTCTTGAATGCCCTTGTATCATTACTC
TAAATAATGGATCGGGCTAGCTCCTTGACGCTTATAAAAAAAAAAAAAAA
AAAAAAAAAAAAA
back to top