CK934442

Overview
NameCK934442
Unique NameCK934442
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length533
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6234 contig Csv1_Contig6234:63..595. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK934442 vs. ExPASy Swiss-Prot
Match: ACBP_RICCO (Acyl-CoA-binding protein OS=Ricinus communis PE=3 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 4.513e-41
Identity = 81/90 (90.00%), Postives = 85/90 (94.44%), Query Frame = 2
Query:   44 MGLQEEFEEHAEKAKTLPESTTNENKLILYGLYKQATVGPVNTNRPGMFNMRDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAGVSA 313
            MGL+E+FEEHAEKAKTLPE+TTNENKLILYGLYKQATVGPVNT+RPGMFNMRDRAKWDAWKAVEGKS EEAMSDYITKVKQL  EA  SA
Sbjct:    1 MGLKEDFEEHAEKAKTLPENTTNENKLILYGLYKQATVGPVNTSRPGMFNMRDRAKWDAWKAVEGKSTEEAMSDYITKVKQLLGEAAASA 90          
BLAST of CK934442 vs. ExPASy Swiss-Prot
Match: ACBP_FRIAG (Acyl-CoA-binding protein OS=Fritillaria agrestis GN=ACABP PE=3 SV=1)

HSP 1 Score: 152.525 bits (384), Expect = 1.150e-36
Identity = 73/86 (84.88%), Postives = 80/86 (93.02%), Query Frame = 2
Query:   44 MGLQEEFEEHAEKAKTLPESTTNENKLILYGLYKQATVGPVNTNRPGMFNMRDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEA 301
            M L+EEFEEHA KAKTLPEST+NENKLILYGLYKQ+TVGPV+T RPGMF+ R+RAKWDAWKAVEGKSKEEAM DYITKVKQL EE+
Sbjct:    1 MALKEEFEEHAVKAKTLPESTSNENKLILYGLYKQSTVGPVDTGRPGMFSPRERAKWDAWKAVEGKSKEEAMGDYITKVKQLLEES 86          
BLAST of CK934442 vs. ExPASy Swiss-Prot
Match: ACBP_GOSHI (Acyl-CoA-binding protein OS=Gossypium hirsutum PE=3 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 3.347e-36
Identity = 72/89 (80.90%), Postives = 80/89 (89.89%), Query Frame = 2
Query:   44 MGLQEEFEEHAEKAKTLPESTTNENKLILYGLYKQATVGPVNTNRPGMFNMRDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAGVS 310
            MGL+EEFEEHAEK KTLP + +N++ LILYGLYKQATVGPVNT+RPGMFNMR++ KWDAWKAVEGKSKEEAM DYITKVKQL E AG S
Sbjct:    1 MGLKEEFEEHAEKVKTLPAAPSNDDMLILYGLYKQATVGPVNTSRPGMFNMREKYKWDAWKAVEGKSKEEAMGDYITKVKQLFEAAGSS 89          
BLAST of CK934442 vs. ExPASy Swiss-Prot
Match: ACBP_BRANA (Acyl-CoA-binding protein OS=Brassica napus PE=3 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 5.908e-33
Identity = 68/90 (75.56%), Postives = 77/90 (85.56%), Query Frame = 2
Query:   44 MGLQEEFEEHAEKAKTLPESTTNENKLILYGLYKQATVGPVNTNRPGMFNMRDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAGVSA 313
            MGL+E+FEEHAEK K L  S +NE+ LILYGLYKQATVGPV T+RPGMF+M++RAKWDAWKAVEGKS +EAMSDYITKVKQL E    SA
Sbjct:    1 MGLKEDFEEHAEKVKKLTASPSNEDLLILYGLYKQATVGPVTTSRPGMFSMKERAKWDAWKAVEGKSTDEAMSDYITKVKQLLEAEASSA 90          
BLAST of CK934442 vs. ExPASy Swiss-Prot
Match: ACBP6_ARATH (Acyl-CoA-binding domain-containing protein 6 OS=Arabidopsis thaliana GN=ACBP6 PE=1 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 2.245e-32
Identity = 67/90 (74.44%), Postives = 76/90 (84.44%), Query Frame = 2
Query:   44 MGLQEEFEEHAEKAKTLPESTTNENKLILYGLYKQATVGPVNTNRPGMFNMRDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAGVSA 313
            MGL+EEFEEHAEK  TL E  +NE+ LILYGLYKQA  GPV+T+RPGMF+M++RAKWDAWKAVEGKS EEAM+DYITKVKQL E A   A
Sbjct:    1 MGLKEEFEEHAEKVNTLTELPSNEDLLILYGLYKQAKFGPVDTSRPGMFSMKERAKWDAWKAVEGKSSEEAMNDYITKVKQLLEVAASKA 90          
BLAST of CK934442 vs. ExPASy Swiss-Prot
Match: ACBP_HUMAN (Acyl-CoA-binding protein OS=Homo sapiens GN=DBI PE=1 SV=2)

HSP 1 Score: 93.9745 bits (232), Expect = 4.855e-19
Identity = 42/85 (49.41%), Postives = 60/85 (70.59%), Query Frame = 2
Query:   53 QEEFEEHAEKAKTLPESTTNENKLILYGLYKQATVGPVNTNRPGMFNMRDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAGV 307
            Q EFE+ AE+ + L    ++E  L +YG YKQATVG +NT RPGM +   +AKWDAW  ++G SKE+AM  YI KV++L+++ G+
Sbjct:    3 QAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI 87          
BLAST of CK934442 vs. ExPASy Swiss-Prot
Match: ACBP_PIG (Acyl-CoA-binding protein OS=Sus scrofa GN=DBI PE=1 SV=2)

HSP 1 Score: 92.8189 bits (229), Expect = 1.082e-18
Identity = 40/85 (47.06%), Postives = 60/85 (70.59%), Query Frame = 2
Query:   53 QEEFEEHAEKAKTLPESTTNENKLILYGLYKQATVGPVNTNRPGMFNMRDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAGV 307
            Q EFE+ AE+ K L     ++  L +Y  YKQATVG +NT RPG+ +++ +AKWDAW  ++G SKE+AM  YI KV++L+++ G+
Sbjct:    3 QAEFEKAAEEVKNLKTKPADDEMLFIYSHYKQATVGDINTERPGILDLKGKAKWDAWNGLKGTSKEDAMKAYINKVEELKKKYGI 87          
BLAST of CK934442 vs. ExPASy Swiss-Prot
Match: ACBP_HYPDU (Putative acyl-CoA-binding protein OS=Hypsibius dujardini PE=3 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.413e-18
Identity = 42/89 (47.19%), Postives = 62/89 (69.66%), Query Frame = 2
Query:   44 MGLQEEFEEHAEKAKTLPESTTNENKLILYGLYKQATVGPVNTNRPGMFNMRDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAGVS 310
            M ++E+F+  AE+ K L  S ++   L LY LYKQAT+G VNT+RPGM  ++++AKWDAW   +G  KE+A   Y+ KVK+L E+ G++
Sbjct:    1 MSVEEQFKTSAEQVKKLKSSPSDTELLELYSLYKQATIGDVNTDRPGMLYLKEKAKWDAWNGRKGLGKEQAQELYVKKVKELVEKNGLA 89          
BLAST of CK934442 vs. ExPASy Swiss-Prot
Match: ACBP_CHAVI (Acyl-CoA-binding protein OS=Chaetophractus villosus GN=DBI PE=1 SV=2)

HSP 1 Score: 92.4337 bits (228), Expect = 1.413e-18
Identity = 40/85 (47.06%), Postives = 59/85 (69.41%), Query Frame = 2
Query:   53 QEEFEEHAEKAKTLPESTTNENKLILYGLYKQATVGPVNTNRPGMFNMRDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAGV 307
            Q EF++ AE+ K L     ++  L +Y  YKQATVG +NT RPGM + + +AKWDAW  ++G SKE+AM  YI KV++L+++ G+
Sbjct:    3 QAEFDKAAEEVKNLKTKPADDEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNQLKGTSKEDAMKSYIDKVEELKKKYGI 87          
BLAST of CK934442 vs. ExPASy Swiss-Prot
Match: ACBP_BOVIN (Acyl-CoA-binding protein OS=Bos taurus GN=DBI PE=1 SV=2)

HSP 1 Score: 92.0485 bits (227), Expect = 1.845e-18
Identity = 41/85 (48.24%), Postives = 59/85 (69.41%), Query Frame = 2
Query:   53 QEEFEEHAEKAKTLPESTTNENKLILYGLYKQATVGPVNTNRPGMFNMRDRAKWDAWKAVEGKSKEEAMSDYITKVKQLQEEAGV 307
            Q EF++ AE+ K L     +E  L +Y  YKQATVG +NT RPGM + + +AKWDAW  ++G SKE+AM  YI KV++L+++ G+
Sbjct:    3 QAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYGI 87          
The following BLAST results are available for this feature:
BLAST of CK934442 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 42
Match NameE-valueIdentityDescription
ACBP_RICCO4.513e-4190.00Acyl-CoA-binding protein OS=Ricinus communis PE=3 ... [more]
ACBP_FRIAG1.150e-3684.88Acyl-CoA-binding protein OS=Fritillaria agrestis G... [more]
ACBP_GOSHI3.347e-3680.90Acyl-CoA-binding protein OS=Gossypium hirsutum PE=... [more]
ACBP_BRANA5.908e-3375.56Acyl-CoA-binding protein OS=Brassica napus PE=3 SV... [more]
ACBP6_ARATH2.245e-3274.44Acyl-CoA-binding domain-containing protein 6 OS=Ar... [more]
ACBP_HUMAN4.855e-1949.41Acyl-CoA-binding protein OS=Homo sapiens GN=DBI PE... [more]
ACBP_PIG1.082e-1847.06Acyl-CoA-binding protein OS=Sus scrofa GN=DBI PE=1... [more]
ACBP_HYPDU1.413e-1847.19Putative acyl-CoA-binding protein OS=Hypsibius duj... [more]
ACBP_CHAVI1.413e-1847.06Acyl-CoA-binding protein OS=Chaetophractus villosu... [more]
ACBP_BOVIN1.845e-1848.24Acyl-CoA-binding protein OS=Bos taurus GN=DBI PE=1... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCGF1004259_A06 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10004_IIF_A06 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK934442 ID=CK934442|Name=CK934442|organism=Citrus sinensis|type=EST|length=533bp
GGGGAATTCNNNAATCTCAGAGAAAAACAAAAGAAAGGGGGAAATGGGTT
TGCAGGAGGAATTTGAGGAGCATGCTGAGAAAGCAAAGACCCTGCCAGAG
TCGACAACAAACGAAAACAAGCTTATCCTTTATGGTCTCTACAAGCAAGC
CACTGTTGGACCAGTAAACACAAACAGACCTGGAATGTTTAACATGAGGG
ACAGAGCTAAGTGGGATGCATGGAAGGCTGTCGAAGGGAAATCTAAGGAG
GAAGCAATGAGTGACTACATTACCAAGGTAAAGCAGTTGCAGGAGGAAGC
TGGTGTTTCTGCCTGACCTTCCGCTGTATGCTTATCTTCCAAATCTCATG
ATTCGGAGAAGTCAAAATAAGTTGAAAAAGGTTTAAGCTGTTTGCAAACT
GGTTCTATTGATGTTACATCTGAATTATGTCTCTGTTTAAATTATGTATG
ATATGTACTTTGGTTAAAGTCCATTGAAATGATTAAGTAGTTTGCGTTAT
CTTGCAAAAAAAAAAAAAAAAAAAAAAAAAAAA
back to top