CK934606

Overview
NameCK934606
Unique NameCK934606
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length714
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10867 contig Csv1_Contig10867:5..717. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK934606 vs. ExPASy Swiss-Prot
Match: NEP1_NEPGR (Aspartic proteinase nepenthesin-1 OS=Nepenthes gracilis GN=nep1 PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.069e-12
Identity = 37/90 (41.11%), Postives = 53/90 (58.89%), Query Frame = 1
Query:  427 ITKLQLAIYNVDR--HELKPAEAQIL-PEDFSTPVVSGASQGSGEYFSRIGVGTPPRQFSMVLGTGSDINWLQCRPCTECYQQSDPIFDP 687
            +TK QL    ++R    L+  EA +  P    T V +G     GEY   + +GTP + FS ++ TGSD+ W QC+PCT+C+ QS PIF+P
Sbjct:   54 LTKFQLLERAIERGSRRLQRLEAMLNGPSGVETSVYAG----DGEYLMNLSIGTPAQPFSAIMDTGSDLIWTQCQPCTQCFNQSTPIFNP 139          
BLAST of CK934606 vs. ExPASy Swiss-Prot
Match: NEP2_NEPGR (Aspartic proteinase nepenthesin-2 OS=Nepenthes gracilis GN=nep2 PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.751e-11
Identity = 34/90 (37.78%), Postives = 49/90 (54.44%), Query Frame = 1
Query:  427 ITKLQLAIYNVDRHELKPAEAQILPEDFS---TPVVSGASQGSGEYFSRIGVGTPPRQFSMVLGTGSDINWLQCRPCTECYQQSDPIFDP 687
            +TK +L    + R E +      + +  S   TPV +G     GEY   + +GTP   FS ++ TGSD+ W QC PCT+C+ Q  PIF+P
Sbjct:   55 LTKYELIKRAIKRGERRMRSINAMLQSSSGIETPVYAG----DGEYLMNVAIGTPDSSFSAIMDTGSDLIWTQCEPCTQCFSQPTPIFNP 140          
The following BLAST results are available for this feature:
BLAST of CK934606 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
NEP1_NEPGR2.069e-1241.11Aspartic proteinase nepenthesin-1 OS=Nepenthes gra... [more]
NEP2_NEPGR1.751e-1137.78Aspartic proteinase nepenthesin-2 OS=Nepenthes gra... [more]
back to top
Properties
Property NameValue
Genbank descriptionCGF1004229_A07 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10002_IVF_A07 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK934606 ID=CK934606; Name=CK934606; organism=Citrus sinensis; type=EST; length=714bp
GGGGAACACTAAACACACTCATCCTCGTTCACTCTTCTTTCCATTTCTCT
GCAACGCAAAAGAAAAAAAGGAAAAAAAATGGCTCCGATTAAGCCATTTG
TTCTCTTCACAATCACAACCATCCTCTTCTCTTTCTGTCTCTTCACCTCC
GCCTCATCCCGCGGCCTATCAGAAACCGCCACGACGGTTCTCGACGTGTC
GTCCGCACTTCAGCAGACCGAACACATCCTCTCCTTCGAGCCCGAGACGC
TTAAACCATTCGCTGAGGAGTCAGAGACAGCAGCAGAGTCTTTTCCTCTC
AACTCTTCTTCTTCGTTCTCATTGCCGCTTCACTCGCGTGAAATCCTCCA
TAAGACGAGACACAATGATTACAGATCACTTGTTTTATCTCGACTCGAGC
GGGACTCAGCCCGAGTCAACACTCTTATCACGAAACTCCAGCTGGCTATC
TACAACGTAGACAGACACGAGCTCAAGCCCGCCGAGGCACAGATCTTGCC
GGAGGATTTCTCCACTCCGGTCGTGTCCGGTGCCAGCCAGGGCAGCGGCG
AATACTTCTCCCGAATTGGCGTCGGTACGCCGCCGAGACAGTTCTCTATG
GTGCTCGGCACCGGCAGTGACATTAACTGGCTTCAGTGCCGGCCTTGTAC
CGAGTGTTATCAACAATCCGATCCGATTTTTGACCCAAAAAAAAAAAAAA
AAAAAAAAAAAAAA
back to top