CK934693

Overview
NameCK934693
Unique NameCK934693
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length640
Libraries
Library NameType
Developing fruit peel at 38 DAFBcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2295 contig Csv1_Contig2295:1..623. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK934693 vs. ExPASy Swiss-Prot
Match: PSBR_ARATH (Photosystem II 10 kDa polypeptide, chloroplastic OS=Arabidopsis thaliana GN=PSBR PE=1 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.054e-46
Identity = 95/128 (74.22%), Postives = 104/128 (81.25%), Query Frame = 2
Query:  107 KPAPFTVEKSAARGLPSL--AKTSFKIVAKG-GKIKTDKPYGVNGGMDLREGLDASGRKAKGKGVYQFVDKYGANVDGYSPIYNENDWSPSGDVYTGGATGLAIWAVTXXXXXXXXXXXVYNTSALAQ 481
            KPA FTVEK+AARGLPSL  A+ SFKIVA G  KIKTDKP+G+NG MDLR+G+DASGRK KG GVY++VDKYGANVDGYSPIYNEN+WS SGDVY GG TGLAIWAVT           VYNTSALAQ
Sbjct:   13 KPAGFTVEKTAARGLPSLTRARPSFKIVASGVKKIKTDKPFGINGSMDLRDGVDASGRKGKGYGVYKYVDKYGANVDGYSPIYNENEWSASGDVYKGGVTGLAIWAVTLAGILAGGALLVYNTSALAQ 140          
BLAST of CK934693 vs. ExPASy Swiss-Prot
Match: PSBR_TOBAC (Photosystem II 10 kDa polypeptide, chloroplastic OS=Nicotiana tabacum GN=PSBR PE=2 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 2.349e-46
Identity = 91/128 (71.09%), Postives = 104/128 (81.25%), Query Frame = 2
Query:  107 KPAPFTVEKSAARGLPSLAKTS--FKIVAKG-GKIKTDKPYGVNGGMDLREGLDASGRKAKGKGVYQFVDKYGANVDGYSPIYNENDWSPSGDVYTGGATGLAIWAVTXXXXXXXXXXXVYNTSALAQ 481
            KPAPF+VEK+A +GLPSLA++S  F++ A G  K+KTDKPYG+NG M LR+G+DASGRK KGKGVYQFVDKYGANVDGYSPIYN +DWSPSGDVY GG TGLAIWAVT           V+NTSALAQ
Sbjct:    9 KPAPFSVEKTAVKGLPSLARSSSSFRVQASGVKKLKTDKPYGINGSMSLRDGVDASGRKQKGKGVYQFVDKYGANVDGYSPIYNTDDWSPSGDVYVGGTTGLAIWAVTLVGILAGGALLVFNTSALAQ 136          
BLAST of CK934693 vs. ExPASy Swiss-Prot
Match: PSBR_BRACM (Photosystem II 10 kDa polypeptide, chloroplastic OS=Brassica campestris GN=PSBR PE=2 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 2.597e-45
Identity = 93/129 (72.09%), Postives = 103/129 (79.84%), Query Frame = 2
Query:  107 KPAPFTVEKSAARGLPSLAK---TSFKIVAKG-GKIKTDKPYGVNGGMDLREGLDASGRKAKGKGVYQFVDKYGANVDGYSPIYNENDWSPSGDVYTGGATGLAIWAVTXXXXXXXXXXXVYNTSALAQ 481
            KPA FTVEK +ARGLPSL +   +SF+IVA G  KIKTDKP+GVNG MDLR+G+DASGRK KG GVY+FVDKYGANVDGYSPIYNE++WS SGDVY GG TGLAIWAVT           VYNTSALAQ
Sbjct:   13 KPAGFTVEKMSARGLPSLTRASPSSFRIVASGVKKIKTDKPFGVNGSMDLRDGVDASGRKGKGYGVYKFVDKYGANVDGYSPIYNEDEWSASGDVYKGGVTGLAIWAVTLAGILAGGALLVYNTSALAQ 141          
BLAST of CK934693 vs. ExPASy Swiss-Prot
Match: PSBR_SOLTU (Photosystem II 10 kDa polypeptide, chloroplastic OS=Solanum tuberosum GN=PSBR PE=2 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 6.397e-44
Identity = 87/124 (70.16%), Postives = 101/124 (81.45%), Query Frame = 2
Query:  119 FTVEKSAARGLPSLAKTS--FKIVAKG-GKIKTDKPYGVNGGMDLREGLDASGRKAKGKGVYQFVDKYGANVDGYSPIYNENDWSPSGDVYTGGATGLAIWAVTXXXXXXXXXXXVYNTSALAQ 481
            FT+EK++ +GLPSLA++S  FK+VA G  K+KTDKPYG+NG M LR+G+DASGRK KGKGVYQ+VDKYGANVDGYSPIYN ++WSPSGDVY GG TGLAIWAVT           VYNTSALAQ
Sbjct:   15 FTLEKTSVKGLPSLARSSSSFKVVASGVKKLKTDKPYGINGSMALRDGVDASGRKPKGKGVYQYVDKYGANVDGYSPIYNTDEWSPSGDVYVGGTTGLAIWAVTLVGILAGGALLVYNTSALAQ 138          
BLAST of CK934693 vs. ExPASy Swiss-Prot
Match: PSBR_SOLLC (Photosystem II 10 kDa polypeptide, chloroplastic OS=Solanum lycopersicum GN=PSBR PE=2 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 4.147e-43
Identity = 86/124 (69.35%), Postives = 99/124 (79.84%), Query Frame = 2
Query:  119 FTVEKSAARGLPSLAKTS--FKIVAKG-GKIKTDKPYGVNGGMDLREGLDASGRKAKGKGVYQFVDKYGANVDGYSPIYNENDWSPSGDVYTGGATGLAIWAVTXXXXXXXXXXXVYNTSALAQ 481
            FT+EK + +GLPSL ++S  FK+VA G  K+KTDKPYG+NG M LR+G+DASGRK KGKGVYQ+VDKYGANVDGYSPIYN ++WSPSGDVY GG TGLAIWAVT           VYNTSALAQ
Sbjct:   15 FTLEKISVKGLPSLTRSSSSFKVVASGVKKLKTDKPYGINGSMALRDGVDASGRKPKGKGVYQYVDKYGANVDGYSPIYNTDEWSPSGDVYVGGTTGLAIWAVTLLGILAGGALLVYNTSALAQ 138          
BLAST of CK934693 vs. ExPASy Swiss-Prot
Match: PSBR_SPIOL (Photosystem II 10 kDa polypeptide, chloroplastic OS=Spinacia oleracea GN=PSBR PE=2 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 2.130e-39
Identity = 83/129 (64.34%), Postives = 97/129 (75.19%), Query Frame = 2
Query:  107 KPAPFTVE-KSAARGLPSLAKTS--FKIVAKG-GKIKTDKPYGVNGGMDLREGLDASGRKAKGKGVYQFVDKYGANVDGYSPIYNENDWSPSGDVYTGGATGLAIWAVTXXXXXXXXXXXVYNTSALAQ 481
            KP+ F V+ KSA +GLPSL+++S  F + A G  KIK DKP G+ GGM LR+G+D+SGRK  GKGVYQFVDKYGANVDGYSPIYNE +W+P+GDVY GG TGL IWAVT           VYNTSALAQ
Sbjct:   12 KPSSFGVDTKSAVKGLPSLSRSSASFTVRASGVKKIKVDKPLGIGGGMKLRDGVDSSGRKPTGKGVYQFVDKYGANVDGYSPIYNEEEWAPTGDVYAGGTTGLLIWAVTLAGLLAGGALLVYNTSALAQ 140          
BLAST of CK934693 vs. ExPASy Swiss-Prot
Match: PSBR_HORVU (Photosystem II 10 kDa polypeptide, chloroplastic OS=Hordeum vulgare GN=PSBR PE=3 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 5.617e-32
Identity = 69/119 (57.98%), Postives = 83/119 (69.75%), Query Frame = 2
Query:  125 VEKSAARGLPSLAKTSFKIVAKGGK-IKTDKPYGVNGGMDLREGLDASGRKAKGKGVYQFVDKYGANVDGYSPIYNENDWSPSGDVYTGGATGLAIWAVTXXXXXXXXXXXVYNTSALA 478
            +++S   G+   A+ S  IVAK  K ++T +PYG  GG+  +EG+DASGR AKGKGVYQF DKYGANVDGYSPIY   +WSPSGDVY GG TGL +WAVT           VY+TSALA
Sbjct:   19 LQRSKLGGVRPSARPSLVIVAKKAKKVQTAQPYGPGGGVAFKEGVDASGRVAKGKGVYQFADKYGANVDGYSPIYTPEEWSPSGDVYVGGKTGLFLWAVTLAGILLGGALLVYSTSALA 137          
The following BLAST results are available for this feature:
BLAST of CK934693 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
PSBR_ARATH1.054e-4674.22Photosystem II 10 kDa polypeptide, chloroplastic O... [more]
PSBR_TOBAC2.349e-4671.09Photosystem II 10 kDa polypeptide, chloroplastic O... [more]
PSBR_BRACM2.597e-4572.09Photosystem II 10 kDa polypeptide, chloroplastic O... [more]
PSBR_SOLTU6.397e-4470.16Photosystem II 10 kDa polypeptide, chloroplastic O... [more]
PSBR_SOLLC4.147e-4369.35Photosystem II 10 kDa polypeptide, chloroplastic O... [more]
PSBR_SPIOL2.130e-3964.34Photosystem II 10 kDa polypeptide, chloroplastic O... [more]
PSBR_HORVU5.617e-3257.98Photosystem II 10 kDa polypeptide, chloroplastic O... [more]
back to top
Properties
Property NameValue
Genbank descriptionCGF1004228_A08 Developing fruit peel at 38 DAFB Citrus sinensis cDNA clone P38DAB10002_IIIF_A08 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK934693 ID=CK934693; Name=CK934693; organism=Citrus sinensis; type=EST; length=640bp
GCGGGGAGTTCAAAGCAAGAAGAAACCCAGANNNTTAACGAAAACAAAAC
AGGAGAGCACAGCAAAGCAAATGGCAGCCTCAGTGATGGCTTCTTCGTTG
AGCCTGAAACCAGCTCCTTTCACTGTGGAGAAATCAGCAGCGAGAGGCCT
TCCCTCTCTTGCTAAAACTTCATTCAAAATTGTGGCTAAAGGCGGCAAGA
TCAAAACCGACAAACCCTATGGAGTAAATGGTGGTATGGATTTGAGGGAA
GGTCTGGATGCATCCGGCAGGAAGGCTAAGGGGAAAGGTGTTTACCAATT
TGTTGACAAGTACGGTGCCAATGTTGATGGATACAGTCCTATCTACAATG
AGAACGACTGGTCTCCCAGTGGTGATGTCTATACTGGTGGTGCAACTGGC
TTGGCAATCTGGGCTGTTACTCTTGCCGGTCTTCTTGCAGGAGGAGCACT
TCTCGTCTACAACACAAGTGCTTTGGCACAGTAGATGAATTTCAATCAAT
GTTACATTATTATCTCTATTTTGTATAACTTGTCAATGTTGCTGTTAAAT
GTACCTTCCACAGCTACTTCGTGTATCTATTTTGTGTAATGTTTTGGGTG
GATTTAAATTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
back to top