CK935179

Overview
NameCK935179
Unique NameCK935179
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length833
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2265 contig Csv1_Contig2265:1..833. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK935179 vs. ExPASy Swiss-Prot
Match: ACCH1_ARATH (1-aminocyclopropane-1-carboxylate oxidase homolog 1 OS=Arabidopsis thaliana GN=At1g06620 PE=2 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 2.113e-41
Identity = 91/241 (37.76%), Postives = 133/241 (55.19%), Query Frame = 3
Query:  111 ATIMSLESYDRAKEVKRFDESXXXXXXXXXXXXTAIPRFFIHPPATLADLRPKSKTRPVSDVVPTIDLSGVDSDDL-RPTIVEKIACASRELGFFQVVNHGIGVEVLERMVRAIKGFHEQPPEIKAPVYRRENTKGVSYISNIDLFHSKAASWRDTLQIRLGLTEPELEEVPEICRKEAVEWNHHVKQXXXXXXXXXXXXXXXKTDRLKEKTFLEGRMMVGHYYPYCPQPDLTVGITSHTD 830
            +++  + + DR+  +K FDE+            T IP  F  PPATL   +P S +      +PTIDL G  +D + R ++VEKI  A+ + GFFQV+NHGI ++VLE+M+  I+ FHEQ  E+K   Y R+    + Y SN DLF S AA+WRDTL        P  E++P  C +  +E++  V +                T+ LK+       +++GHYYP CPQPDLT+G+T H+D
Sbjct:    3 SSLPQVAALDRSTLLKAFDETKTGVKGLIDAGITEIPSIFRAPPATLTSPKPPSSS---DFSIPTIDLKGGGTDSITRRSLVEKIGDAAEKWGFFQVINHGIPMDVLEKMIDGIREFHEQDTEVKKGFYSRDPASKMVYSSNFDLFSSPAANWRDTLGCYTAPDPPRPEDLPATCGEMMIEYSKEVMKLGKLLFELLSEALGLNTNHLKDMDCTNSLLLLGHYYPPCPQPDLTLGLTKHSD 240          
BLAST of CK935179 vs. ExPASy Swiss-Prot
Match: ACCH3_ARATH (1-aminocyclopropane-1-carboxylate oxidase homolog 4 OS=Arabidopsis thaliana GN=At1g06650 PE=2 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 2.336e-40
Identity = 83/234 (35.47%), Postives = 128/234 (54.70%), Query Frame = 3
Query:  135 YDRAKEVKRFDESXXXXXXXXXXXXTAIPRFFIHPPATLADLRPKSKTRPVSDVVPTIDLSGVDSDDL--RPTIVEKIACASRELGFFQVVNHGIGVEVLERMVRAIKGFHEQPPEIKAPVYRRENTKGVSYISNIDLFHSKAASWRDTLQIRLGLTEPELEEVPEICRKEAVEWNHHVKQXXXXXXXXXXXXXXXKTDRLKEKTFLEGRMMVGHYYPYCPQPDLTVGITSHTD 830
            +DRA E+K FDE+            + +PR F HP   L+  +P          +PTIDL G D  D   R   +E+I  A+ + GFFQV+NHG+ +E+LE+M + ++ FHEQ  E++   Y R+ ++   Y+SN DLF S AA+WRDT    +    P+ +++PEICR   +E++  V                 + + L +    +G +M+ HYYP CP+PDLT+G + H+D
Sbjct:   10 FDRASELKAFDETKTGVKGLVDSGVSQVPRIFHHPTVKLSTPKPLPSDLLHLKTIPTIDLGGRDFQDAIKRNNAIEEIKEAAAKWGFFQVINHGVSLELLEKMKKGVRDFHEQSQEVRKEFYSRDFSRRFLYLSNFDLFSSPAANWRDTFSCTMAPDTPKPQDLPEICRDIMMEYSKQVMNLGKFLFELLSEALGLEPNHLNDMDCSKGLLMLSHYYPPCPEPDLTLGTSQHSD 243          
BLAST of CK935179 vs. ExPASy Swiss-Prot
Match: GSL_ARATH (Probable 2-oxoacid dependent dioxygenase OS=Arabidopsis thaliana GN=GSL-OH PE=2 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 5.204e-40
Identity = 85/235 (36.17%), Postives = 131/235 (55.74%), Query Frame = 3
Query:  129 ESYDRAKEVKRFDESXXXXXXXXXXXXTAIPRFFIHPPATLADLRPKSKTRPVSDVVPTIDLSGV-DSDDLRPTIVEKIACASRELGFFQVVNHGIGVEVLERMVRAIKGFHEQPPEIKAPVYRRENTKGVSYISNIDLFHSKAASWRDTLQIRLGLTEPELEEVPEICRKEAVEWNHHVKQXXXXXXXXXXXXXXXKTDRLKEKTFLEGRMMVGHYYPYCPQPDLTVGITSHTD 830
            E+YDRA E+K FDE             T +PR F +P   +A+ +P S       ++PTIDL GV +S  +R ++V K+  A  + GFFQ +NHG+ ++V+E+M+  I+ FH+Q PE++   Y R+ TK + Y SN DL+ S AASWRDTL   +    P+ +++PE+C +  +E++  V +                 + LKE    +G  M+ H +P CP+P+ T G   HTD
Sbjct:    3 ENYDRASELKAFDEMKIGVKGLVDAGVTKVPRIFHNPHVNVANPKPTSTVV----MIPTIDLGGVFESTVVRESVVAKVKDAMEKFGFFQAINHGVPLDVMEKMINGIRRFHDQDPEVRKMFYTRDKTKKLKYHSNADLYESPAASWRDTLSCVMAPDVPKAQDLPEVCGEIMLEYSKEVMKLAELMFEILSEALGLSPNHLKEMDCAKGLWMLCHCFPPCPEPNRTFGGAQHTD 233          
BLAST of CK935179 vs. ExPASy Swiss-Prot
Match: ACCH2_ARATH (1-aminocyclopropane-1-carboxylate oxidase homolog 2 OS=Arabidopsis thaliana GN=At1g06640 PE=2 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 5.204e-40
Identity = 86/235 (36.60%), Postives = 127/235 (54.04%), Query Frame = 3
Query:  132 SYDRAKEVKRFDESXXXXXXXXXXXXTAIPRFFIHPPATLADLRPKSKTRPVSDVVPTIDLSGVDSDDL--RPTIVEKIACASRELGFFQVVNHGIGVEVLERMVRAIKGFHEQPPEIKAPVYRRENTKGVSYISNIDLFHSKAASWRDTLQIRLGLTEPELEEVPEICRKEAVEWNHHVKQXXXXXXXXXXXXXXXKTDRLKEKTFLEGRMMVGHYYPYCPQPDLTVGITSHTD 830
            S+DRA E+K FDE+            + IPR F H    LA+ +P          +PTIDL G D  D       +E I  A+ + GFFQV+NHG+ +E+LE+M   ++ FHEQPPE++  +Y R+  +   Y+SN DL+ + AA+WRDT    +    PE +++PEICR   +E++  V                   + LK+   L+G  M+ HY+P CP+PDLT G + H+D
Sbjct:    9 SFDRASELKAFDETKTGVKGLVDSGISKIPRIFHHSSVELANPKPLPSDLLHLKTIPTIDLGGRDFQDAIKHKNAIEGIKEAAAKWGFFQVINHGVSLELLEKMKDGVRDFHEQPPEVRKDLYSRDFGRKFIYLSNFDLYTAAAANWRDTFYCYMAPDPPEPQDLPEICRDVMMEYSKQVMILGEFLFELLSEALGLNPNHLKDMECLKGLRMLCHYFPPCPEPDLTFGTSKHSD 243          
BLAST of CK935179 vs. ExPASy Swiss-Prot
Match: DV4H_CATRO (Deacetoxyvindoline 4-hydroxylase OS=Catharanthus roseus GN=D4H PE=1 SV=2)

HSP 1 Score: 156.377 bits (394), Expect = 1.851e-37
Identity = 86/239 (35.98%), Postives = 134/239 (56.07%), Query Frame = 3
Query:  123 SLESYDRAKEVKRFDESXXXXXXXXXXXXTAIPRFFIHPPATLADLRPKSKTRPVSDV-VPTIDLSGVDSD-DLRPTIVEKIACASRELGFFQVVNHGIGVEVLERMVRAIKGFHEQPPEIKAPVYRREN-TKGVSYISNIDLFHSKAASWRDTLQIRLGLTEPELEEVPEICRKEAVEWNHHVKQXXXXXXXXXXXXXXXKTDRLKEKTFLEGRMMVGHYYPYCPQPDLTVGITSHTD 830
            +L   +  +E+K FDE+            T IPR FI  P  L  +   S  R  SD+ +P I+L+G+ S+ ++R  IVEKI  AS + GFFQ+VNHGI  +V+++MV  ++ FHEQ  +IK   Y R+   K   Y SN  L    A +WRDT++  +   +P+ +E P++CR   ++++++V+                K + L+E    EG +++GHYYP CPQP+LT G + H+D
Sbjct:   35 TLSEEESLRELKAFDETKAGVKGIVDTGITKIPRIFIDQPKNLDRI---SVCRGKSDIKIPVINLNGLSSNSEIRREIVEKIGEASEKYGFFQIVNHGIPQDVMDKMVDGVRKFHEQDDQIKRQYYSRDRFNKNFLYSSNYVLIPGIACNWRDTMECIMNSNQPDPQEFPDVCRDILMKYSNYVRNLGLILFELLSEALGLKPNHLEEMDCAEGLILLGHYYPACPQPELTFGTSKHSD 270          
BLAST of CK935179 vs. ExPASy Swiss-Prot
Match: ACCH3_SOLLC (1-aminocyclopropane-1-carboxylate oxidase homolog OS=Solanum lycopersicum GN=ACO3 PE=2 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 2.502e-34
Identity = 84/237 (35.44%), Postives = 121/237 (51.05%), Query Frame = 3
Query:  129 ESYDRAKEVKRFDESXXXXXXXXXXXXTAIPRFFIHPPATLADLRPKSKTRPVSDVVPTIDLSGVDSDDLR-PTIVEKIACASRELGFFQVVNHGIGVEVLERMVRAIKGFHEQPPEIKAPVYRRENTKGVSYISNIDLFHSK--AASWRDTLQIRLGLTEPELEEVPEICRKEAVEWNHHVKQXXXXXXXXXXXXXXXKTDRLKEKTFLEGRMMVGHYYPYCPQPDLTVGITSHTD 830
            ESYD+  E+K FD++            T +P+ F+ PP      + ++K      V P IDL G+D D ++   IV+K+  AS + GFFQVVNHGI   VL+R ++  + F EQ  E+K   Y R+  K V Y SN+DL+ S   AASWRDT+   +    P L+E P  C +  ++++  VK+                   LK+           +YYP CPQP+LT+G   HTD
Sbjct:    8 ESYDKMSELKAFDDTKAGVKGLVDSGITKVPQIFVLPP------KDRAKKCETHFVFPVIDLQGIDEDPIKHKEIVDKVRDASEKWGFFQVVNHGIPTSVLDRTLQGTRQFFEQDNEVKKQYYTRDTAKKVVYTSNLDLYKSSVPAASWRDTIFCYMAPNPPSLQEFPTPCGESLIDFSKDVKKLGFTLLELLSEGLGLDRSYLKDYMDCFHLFCSCNYYPPCPQPELTMGTIQHTD 238          
BLAST of CK935179 vs. ExPASy Swiss-Prot
Match: FLS1_ARATH (Flavonol synthase/flavanone 3-hydroxylase OS=Arabidopsis thaliana GN=FLS1 PE=1 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.686e-14
Identity = 62/198 (31.31%), Postives = 89/198 (44.95%), Query Frame = 3
Query:  279 RPVSDVVPTIDLSGVDSDDLRPTIVEKIACASRELGFFQVVNHGIGVEVLERMVRAIKGFHEQPPEIKAPVYRRENTKGV-SYISNIDLFHSKAASWRDTLQIRL-----------GLTEPELEEVPEICRKEAVEWNHHVKQXXXXXXXXXXXXXXXKTDRLKEKT--FLEGRMMVGHYYPYCPQPDLTVGITSHTD 830
            R  +  +P +DLS  D + +R  +V+    AS E G FQVVNHGI  E++ R+    + F E P   K  V + E++K +  Y + +        +W D L  R+               PE  EV E       E+  HVK+               K D LKE     +   MM  +YYP CP+PDL +G+ +HTD
Sbjct:   37 RGPTPAIPVVDLSDPDEESVRRAVVK----ASEEWGLFQVVNHGIPTELIRRLQDVGRKFFELPSSEKESVAKPEDSKDIEGYGTKLQKDPEGKKAWVDHLFHRIWPPSCVNYRFWPKNPPEYREVNE-------EYAVHVKKLSETLLGILSDGLGLKRDALKEGLGGEMAEYMMKINYYPPCPRPDLALGVPAHTD 223          
BLAST of CK935179 vs. ExPASy Swiss-Prot
Match: FL3H_ARATH (Naringenin,2-oxoglutarate 3-dioxygenase OS=Arabidopsis thaliana GN=F3H PE=1 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 6.406e-14
Identity = 58/201 (28.86%), Postives = 85/201 (42.29%), Query Frame = 3
Query:  255 DLRPKSKTRPVSDVVPTIDLSGVDS-DDLRPTIVEKIACASRELGFFQVVNHGIGVEVLERMVRAIKGFHEQPPEIKAPVYRRENTKGVSYISNIDLFHSKAASWRDTLQIRLGLTEP-------ELEEVPEICRKEAVEWNHHVKQXXXXXXXXXXXXXXXKTDRLKEKTFLEGRMMVGHYYPYCPQPDLTVGITSHTDP 833
            D RPK      SD +P I L+G+D  D  R  I  +I  A    G FQVV+HG+   ++  M R  + F   PPE K         KG   +S+    H +  + +D  +I    + P          + PE   K   E++  +                 + + L        + +V +YYP CPQPDLT+G+  HTDP
Sbjct:   24 DERPKVAYNVFSDEIPVISLAGIDDVDGKRGEICRQIVEACENWGIFQVVDHGVDTNLVADMTRLARDFFALPPEDKLRFDMSGGKKGGFIVSS----HLQGEAVQDWREIVTYFSYPVRNRDYSRWPDKPEGWVKVTEEYSERLMSLACKLLEVLSEAMGLEKESLTNACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDP 220          
BLAST of CK935179 vs. ExPASy Swiss-Prot
Match: FL3H_MATIN (Naringenin,2-oxoglutarate 3-dioxygenase (Fragment) OS=Matthiola incana GN=FHT PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.427e-13
Identity = 57/201 (28.36%), Postives = 85/201 (42.29%), Query Frame = 3
Query:  255 DLRPKSKTRPVSDVVPTIDLSGVDS-DDLRPTIVEKIACASRELGFFQVVNHGIGVEVLERMVRAIKGFHEQPPEIKAPVYRRENTKGVSYISNIDLFHSKAASWRDTLQIRLGLTEP-------ELEEVPEICRKEAVEWNHHVKQXXXXXXXXXXXXXXXKTDRLKEKTFLEGRMMVGHYYPYCPQPDLTVGITSHTDP 833
            D RPK      SD +P I L+G+D  D  R  I  +I  A    G FQVV+HG+   ++  M R  + F   PPE K         KG   +S+    H +  + +D  +I    + P          + P+   K   E++  +                 + + L        + +V +YYP CPQPDLT+G+  HTDP
Sbjct:   23 DERPKVAYNEFSDEIPVISLAGIDDVDGKRGEICREIVEACENWGIFQVVDHGVDTSLVADMTRLARDFFALPPEEKLRFDMSGGKKGGFIVSS----HLQGEAVQDWREIVTYFSYPVRNRDYSRWPDKPQGWAKVTEEYSEKLMGLACKLLEVLSEAMGLEKESLTNACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDP 219          
BLAST of CK935179 vs. ExPASy Swiss-Prot
Match: FL3H_DIACA (Naringenin,2-oxoglutarate 3-dioxygenase OS=Dianthus caryophyllus GN=FHT PE=2 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.427e-13
Identity = 57/197 (28.93%), Postives = 86/197 (43.65%), Query Frame = 3
Query:  255 DLRPKSKTRPVSDVVPTIDLSGVDSDDLRPTIVEKIACASRELGFFQVVNHGIGVEVLERMVRAIKGFHEQPPEIKAPVYRRENTKGVSYISNIDLFHSKAASWRDTLQIRLGLTEPE----LEEVPEICRKEAVEWNHHVKQXXXXXXXXXXXXXXXKTDRLKEKTFLEGRMMVGHYYPYCPQPDLTVGITSHTDP 833
            D RPK      S+ +P I L+G+D +  R  I  KI  A  + G FQVV+HG+G +++  M R  + F   P E K         KG  +I +  L       WR+ +      T         + PE   K   E+++ +                 + + L +      + +V +YYP CPQPDLT+G+  HTDP
Sbjct:   27 DERPKVAYNEFSNDIPVISLAGIDGEK-RGEICRKIVEACEDWGIFQVVDHGVGDDLIADMTRLAREFFALPAEEKLRFDMSGGKKG-GFIVSSHLQGEVVQDWREIVTYFSYPTNSRDYTRWPDKPEGWIKVTEEYSNKLMTLACTLLGVLSEAMGLELEALTKACVDMDQKIVVNYYPKCPQPDLTLGLKRHTDP 221          
The following BLAST results are available for this feature:
BLAST of CK935179 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
ACCH1_ARATH2.113e-4137.761-aminocyclopropane-1-carboxylate oxidase homolog ... [more]
ACCH3_ARATH2.336e-4035.471-aminocyclopropane-1-carboxylate oxidase homolog ... [more]
GSL_ARATH5.204e-4036.17Probable 2-oxoacid dependent dioxygenase OS=Arabid... [more]
ACCH2_ARATH5.204e-4036.601-aminocyclopropane-1-carboxylate oxidase homolog ... [more]
DV4H_CATRO1.851e-3735.98Deacetoxyvindoline 4-hydroxylase OS=Catharanthus r... [more]
ACCH3_SOLLC2.502e-3435.441-aminocyclopropane-1-carboxylate oxidase homolog ... [more]
FLS1_ARATH1.686e-1431.31Flavonol synthase/flavanone 3-hydroxylase OS=Arabi... [more]
FL3H_ARATH6.406e-1428.86Naringenin,2-oxoglutarate 3-dioxygenase OS=Arabido... [more]
FL3H_MATIN1.427e-1328.36Naringenin,2-oxoglutarate 3-dioxygenase (Fragment)... [more]
FL3H_DIACA1.427e-1328.93Naringenin,2-oxoglutarate 3-dioxygenase OS=Dianthu... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit 24 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004564_H10 Developing fruit 24 DAFB Citrus sinensis cDNA clone T24DAB0001_IIIF_H10 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK935179 ID=CK935179|Name=CK935179|organism=Citrus sinensis|type=EST|length=833bp
AGGGGTTAAGTAATTGTATTACCAAACTAGTGAAACAAAACAGAAAAATG
CTAAAACCACTCCATTCATTTGTTTCAACTCAAGATATCAAATATCAATT
AACAAGAAGAGCTACAATCATGAGCCTAGAATCATACGACAGGGCCAAAG
AAGTGAAACGATTCGACGAGTCCAAAGTCGGGGTCAAAGGTTTAGTTGAC
TTGGGCGTCACCGCCATCCCCCGCTTTTTCATCCACCCACCCGCCACTCT
TGCCGATCTCAGACCCAAGTCAAAGACCCGGCCCGTCTCTGATGTAGTCC
CCACCATCGATTTATCGGGCGTTGACTCGGACGATCTGCGGCCGACGATT
GTGGAAAAGATAGCATGTGCCTCGCGGGAGCTGGGGTTCTTTCAGGTTGT
GAATCACGGCATCGGAGTTGAGGTCTTGGAGCGTATGGTTCGGGCCATTA
AAGGGTTTCATGAACAGCCGCCGGAGATCAAGGCGCCGGTGTATCGTAGG
GAGAACACCAAAGGCGTGTCTTACATTTCCAACATCGATTTGTTTCACTC
TAAAGCTGCCAGCTGGAGGGACACACTGCAGATAAGGCTAGGTCTGACGG
AACCAGAGCTTGAAGAAGTTCCTGAAATATGTAGGAAAGAGGCAGTCGAG
TGGAACCACCATGTAAAACAGCTCGGAGAGCTTTTGTTTGGGCTGCTGTG
TGAAGGTTTGGGGTTGAAAACCGATAGGTTGAAGGAAAAGACCTTCCTGG
AAGGGAGGATGATGGTGGGCCATTATTATCCCTACTGTCCGCAGCCTGAT
CTGACAGTGGGGATCACATCTCATACTGATCCA
back to top