CK935201

Overview
NameCK935201
Unique NameCK935201
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length821
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13581 contig Csv1_Contig13581:7..827. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK935201 vs. ExPASy Swiss-Prot
Match: ABHD5_MOUSE (1-acylglycerol-3-phosphate O-acyltransferase ABHD5 OS=Mus musculus GN=Abhd5 PE=1 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 5.820e-28
Identity = 74/177 (41.81%), Postives = 101/177 (57.06%), Query Frame = 2
Query:  221 WIPTSTNHIIAAEKRLLSIIKTPYVQEQVNIGSSPPGSKIRWFRSSSDEPRFINTVTFDSKEDSPT-LIMVHGYGASQGFFFRNFDALASRFRVIAIDQLGCGGSSRPDFTCKSTEETEAWFIDSFEEWRKAKNLSNFILLGHSLGGYVAAKYALKHPEHVQHLILVGPAGFSAQSD 748
            W PTST+H+  AE+++L  +   Y +E V I +   G++I W            T+ F     S T L+++HG+G   G +  NF+ L++   V A D LG G SSRP F     EE E  F++S EEWR A  L   ILLGH+LGG++AA Y+LK+P  V HLILV P GF  + D
Sbjct:   29 WCPTSTSHLKEAEEKMLKCVPCTYKKEPVRISN---GNRI-W------------TLMFSHNISSKTPLVLLHGFGGGLGLWALNFEDLSTDRPVYAFDLLGFGRSSRPRFD-SDAEEVENQFVESIEEWRCALRLDKMILLGHNLGGFLAAAYSLKYPSRVSHLILVEPWGFPERPD 188          
BLAST of CK935201 vs. ExPASy Swiss-Prot
Match: ABHD5_RAT (1-acylglycerol-3-phosphate O-acyltransferase ABHD5 OS=Rattus norvegicus GN=Abhd5 PE=1 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 7.602e-28
Identity = 74/177 (41.81%), Postives = 100/177 (56.50%), Query Frame = 2
Query:  221 WIPTSTNHIIAAEKRLLSIIKTPYVQEQVNIGSSPPGSKIRWFRSSSDEPRFINTVTFDSKEDSPT-LIMVHGYGASQGFFFRNFDALASRFRVIAIDQLGCGGSSRPDFTCKSTEETEAWFIDSFEEWRKAKNLSNFILLGHSLGGYVAAKYALKHPEHVQHLILVGPAGFSAQSD 748
            W PTST+H+  AE+++L  +   Y +E V I +   G+ I W            T+ F     S T L+++HG+G   G +  NF+ L++   V A D LG G SSRP F     EE E  F++S EEWR A  L   ILLGH+LGG++AA Y+LK+P  V HLILV P GF  + D
Sbjct:   29 WCPTSTSHLKEAEEKMLKCVPCTYKKEPVRISN---GNSI-W------------TLMFSHNMSSKTPLVLLHGFGGGLGLWALNFEDLSTDRPVYAFDLLGFGRSSRPRFD-SDAEEVENQFVESIEEWRCALRLDKMILLGHNLGGFLAAAYSLKYPSRVSHLILVEPWGFPERPD 188          
BLAST of CK935201 vs. ExPASy Swiss-Prot
Match: ABHD5_PONAB (1-acylglycerol-3-phosphate O-acyltransferase ABHD5 OS=Pongo abelii GN=ABHD5 PE=1 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 7.602e-28
Identity = 74/177 (41.81%), Postives = 100/177 (56.50%), Query Frame = 2
Query:  221 WIPTSTNHIIAAEKRLLSIIKTPYVQEQVNIGSSPPGSKIRWFRSSSDEPRFINTVTFDSKEDSPT-LIMVHGYGASQGFFFRNFDALASRFRVIAIDQLGCGGSSRPDFTCKSTEETEAWFIDSFEEWRKAKNLSNFILLGHSLGGYVAAKYALKHPEHVQHLILVGPAGFSAQSD 748
            W PTST+H+  AE+++L  +   Y +E V+I +   G+KI W            T+ F     + T L+++HG+G   G +  NF  L +   V A D LG G SSRP F     EE E  F++S EEWR A  L   ILLGH+LGG++AA Y+LK+P  V HLILV P GF  + D
Sbjct:   27 WCPTSTSHLKEAEEKMLKCVPCTYKKEPVHISN---GNKI-W------------TLKFSHNISNKTPLVLLHGFGGGLGLWALNFGDLCTNRPVYAFDLLGFGRSSRPRFD-SDAEEVENQFVESIEEWRCALGLDKMILLGHNLGGFLAAAYSLKYPSRVNHLILVEPWGFPERPD 186          
BLAST of CK935201 vs. ExPASy Swiss-Prot
Match: ABHD5_HUMAN (1-acylglycerol-3-phosphate O-acyltransferase ABHD5 OS=Homo sapiens GN=ABHD5 PE=1 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 4.927e-27
Identity = 73/177 (41.24%), Postives = 98/177 (55.37%), Query Frame = 2
Query:  221 WIPTSTNHIIAAEKRLLSIIKTPYVQEQVNIGSSPPGSKIRWFRSSSDEPRFINTVTFDSKEDSPT-LIMVHGYGASQGFFFRNFDALASRFRVIAIDQLGCGGSSRPDFTCKSTEETEAWFIDSFEEWRKAKNLSNFILLGHSLGGYVAAKYALKHPEHVQHLILVGPAGFSAQSD 748
            W PTS +H+  AE+++L  +   Y +E V I +   G+KI W            T+ F     + T L+++HG+G   G +  NF  L +   V A D LG G SSRP F     EE E  F++S EEWR A  L   ILLGH+LGG++AA Y+LK+P  V HLILV P GF  + D
Sbjct:   27 WCPTSISHLKEAEEKMLKCVPCTYKKEPVRISN---GNKI-W------------TLKFSHNISNKTPLVLLHGFGGGLGLWALNFGDLCTNRPVYAFDLLGFGRSSRPRFD-SDAEEVENQFVESIEEWRCALGLDKMILLGHNLGGFLAAAYSLKYPSRVNHLILVEPWGFPERPD 186          
BLAST of CK935201 vs. ExPASy Swiss-Prot
Match: ABHD5_PIG (1-acylglycerol-3-phosphate O-acyltransferase ABHD5 OS=Sus scrofa GN=ABHD5 PE=1 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 5.448e-26
Identity = 71/176 (40.34%), Postives = 97/176 (55.11%), Query Frame = 2
Query:  221 WIPTSTNHIIAAEKRLLSIIKTPYVQEQVNIGSSPPGSKIRWFRSSSDEPRFINTVTFDSKEDSPTLIMVHGYGASQGFFFRNFDALASRFRVIAIDQLGCGGSSRPDFTCKSTEETEAWFIDSFEEWRKAKNLSNFILLGHSLGGYVAAKYALKHPEHVQHLILVGPAGFSAQSD 748
            W PTST+H+  AE+++L  +   Y +  V I +   G+KI   + S +    I             L+++HG+G   G +  NF  L +   V A D LG G SSRP F   + EE E  F++S EEWR A  L   ILLGH+LGG++AA Y+LK+P  V HLILV P GF  + D
Sbjct:   27 WCPTSTSHLKEAEEKILKCVPCIYKKGPVRISN---GNKIWTLKLSHNISNKI------------PLVLLHGFGGGLGLWALNFGDLCTNRPVYAFDLLGFGRSSRPRFDTDA-EEVENQFVESIEEWRCALGLDKVILLGHNLGGFLAAAYSLKYPSRVSHLILVEPWGFPERPD 186          
BLAST of CK935201 vs. ExPASy Swiss-Prot
Match: ABHD4_MOUSE (Abhydrolase domain-containing protein 4 OS=Mus musculus GN=Abhd4 PE=2 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 1.214e-25
Identity = 72/200 (36.00%), Postives = 109/200 (54.50%), Query Frame = 2
Query:  221 WIPTSTNHIIAAEKRLLSIIKTPYVQEQVNIGSSPPGSKIRWFRSSSDEPRFINTVTFDSKEDSPTLIMVHGYGASQGFFFRNFDALASRFRVIAIDQLGCGGSSRPDFTCKSTEETEAWFIDSFEEWRKAKNLSNFILLGHSLGGYVAAKYALKHPEHVQHLILVGPAGFSAQSDAKSEWITKFRATWKRAILNHLWES 820
            W PTS + +   E R+L  ++  ++   V++   P  +KI           +  TV+ + K+ +P L+MVHG+G   G +  N D+L++R  +   D LG G SSRP F  +  E  E  F+ S E WR+   +   ILLGHSLGG++A  Y++K+PE V+HLILV P GF  +    SE   +   TW +A+ + L  S
Sbjct:   20 WRPTSMSQLKNVEARILQCLQNKFLARYVSL---PNQNKI-----------WTVTVSPEQKDRTP-LVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPTFP-RDPEGAEDEFVASIETWRETMGIPTMILLGHSLGGFLATSYSIKYPERVKHLILVDPWGFPLRPTDPSE--IRAPPTWVKAVASVLGRS 201          
BLAST of CK935201 vs. ExPASy Swiss-Prot
Match: ABHD4_BOVIN (Abhydrolase domain-containing protein 4 OS=Bos taurus GN=ABHD4 PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 2.704e-25
Identity = 71/200 (35.50%), Postives = 108/200 (54.00%), Query Frame = 2
Query:  221 WIPTSTNHIIAAEKRLLSIIKTPYVQEQVNIGSSPPGSKIRWFRSSSDEPRFINTVTFDSKEDSPTLIMVHGYGASQGFFFRNFDALASRFRVIAIDQLGCGGSSRPDFTCKSTEETEAWFIDSFEEWRKAKNLSNFILLGHSLGGYVAAKYALKHPEHVQHLILVGPAGFSAQSDAKSEWITKFRATWKRAILNHLWES 820
            W PTS + +   E R+L  ++  ++   V++   P  +KI W  + S E R           D   L+MVHG+G   G +  N D+L++R  +   D LG G SSRP F  +  E  E  F+ S E WR++  + + ILLGHSLGG++A  Y++K+P+ V+HLILV P GF  +    S+   +   TW +A+ + L  S
Sbjct:   20 WRPTSMSQLKNVEARILQCLQNKFLARYVSL---PNQNKI-WTVTVSPELR-----------DRTPLVMVHGFGGGVGLWILNMDSLSTRRTLHTFDLLGFGRSSRPTFP-RDPEGAEDEFVTSIETWRESMGIPSMILLGHSLGGFLATSYSIKYPDRVKHLILVDPWGFPLRPADPSQ--VRAPPTWVKAVASVLGRS 201          
BLAST of CK935201 vs. ExPASy Swiss-Prot
Match: ABHD4_HUMAN (Abhydrolase domain-containing protein 4 OS=Homo sapiens GN=ABHD4 PE=2 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 1.027e-24
Identity = 70/200 (35.00%), Postives = 106/200 (53.00%), Query Frame = 2
Query:  221 WIPTSTNHIIAAEKRLLSIIKTPYVQEQVNIGSSPPGSKIRWFRSSSDEPRFINTVTFDSKEDSPTLIMVHGYGASQGFFFRNFDALASRFRVIAIDQLGCGGSSRPDFTCKSTEETEAWFIDSFEEWRKAKNLSNFILLGHSLGGYVAAKYALKHPEHVQHLILVGPAGFSAQSDAKSEWITKFRATWKRAILNHLWES 820
            W PTS + +   E R+L  ++  ++   V++   P  +KI W  + S E           + D   L+MVHG+G   G +  N D+L++R  +   D LG G SSRP F  +  E  E  F+ S E WR+   + + ILLGHSLGG++A  Y++K+P+ V+HLILV P GF  +    SE   +    W +A+ + L  S
Sbjct:   20 WRPTSMSQLKNVEARILQCLQNKFLARYVSL---PNQNKI-WTVTVSPE-----------QNDRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPAFP-RDPEGAEDEFVTSIETWRETMGIPSMILLGHSLGGFLATSYSIKYPDRVKHLILVDPWGFPLRPTNPSE--IRAPPAWVKAVASVLGRS 201          
BLAST of CK935201 vs. ExPASy Swiss-Prot
Match: YE63_SCHPO (Uncharacterized protein C6G10.03c OS=Schizosaccharomyces pombe GN=SPAC6G10.03c PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 2.369e-21
Identity = 54/133 (40.60%), Postives = 76/133 (57.14%), Query Frame = 2
Query:  401 KEDSPTLIMVHGYGASQGFFFRNFDALASR----FRVIAIDQLGCGGSSRPDFTCKS------TEETEAWFIDSFEEWRKAKNLSNFILLGHSLGGYVAAKYALKHPEHVQHLILVGPAG-----FSAQSDAK 754
            K +  +++ +HGYGA  GF+FRN D L       F    +D LG G SSRP F  K        EETE +F +S E WR    +   IL+GHS+GGY++A YA+++PE V+ L+LV P       F++  DA+
Sbjct:   88 KANKRSIVYMHGYGAGLGFYFRNMDGLTKGVTKDFNSYFVDWLGMGNSSRPPFDIKGQTASEKVEETERFFTESLETWRIGHGIEKMILVGHSMGGYLSAVYAMQYPERVEKLLLVSPVAIPENPFASNDDAE 220          
BLAST of CK935201 vs. ExPASy Swiss-Prot
Match: ICT1_YEAST (1-acylglycerol-3-phosphate O-acyltransferase ICT1 OS=Saccharomyces cerevisiae GN=ICT1 PE=1 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 2.147e-14
Identity = 55/215 (25.58%), Postives = 96/215 (44.65%), Query Frame = 2
Query:  203 WPSVLRWIPTSTNHIIAAEKRLLSIIK-TPYVQEQVNIGSSPPGSKIRWFRSSSDEPRFINTVTFDSKEDS----PTLIMVHGYGASQGFFFRNFDALASRFR-VIAIDQLGCGGSSRPDFTCKST---------------------------------EETEAWFIDSFEEWRKAKNLSNFILLGHSLGGYVAAKYALKHPEHVQHLILVGPAG 730
            W +  +W   +      A+ ++ + ++    +Q+Q+   ++  GS      +++  P  IN   F +K  +    PT +++HGY AS   F+R F+ L+   + + AID    G S  P      T                                 E+ E++F+D  E+WRK   L    ++GHS GGY++ KYALK+P+ ++ L L+ P G
Sbjct:    2 WTNTFKWCSKTEKETTTADAKVCASVQGLKALQQQIMDSTTVRGSV-----NNTMTPGGINQWHFHNKRANKVCTPT-VLIHGYAASSMAFYRTFENLSDNIKDLYAIDLPANGASEAPALQVNKTKKIKSLRFKHIEDDVVIPVIEKRPPAEDIKSHLEQYESYFVDRIEQWRKDNKLRKINVVGHSFGGYISFKYALKYPDSIEKLCLISPLG 210          
The following BLAST results are available for this feature:
BLAST of CK935201 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
ABHD5_MOUSE5.820e-2841.811-acylglycerol-3-phosphate O-acyltransferase ABHD5... [more]
ABHD5_RAT7.602e-2841.811-acylglycerol-3-phosphate O-acyltransferase ABHD5... [more]
ABHD5_PONAB7.602e-2841.811-acylglycerol-3-phosphate O-acyltransferase ABHD5... [more]
ABHD5_HUMAN4.927e-2741.241-acylglycerol-3-phosphate O-acyltransferase ABHD5... [more]
ABHD5_PIG5.448e-2640.341-acylglycerol-3-phosphate O-acyltransferase ABHD5... [more]
ABHD4_MOUSE1.214e-2536.00Abhydrolase domain-containing protein 4 OS=Mus mus... [more]
ABHD4_BOVIN2.704e-2535.50Abhydrolase domain-containing protein 4 OS=Bos tau... [more]
ABHD4_HUMAN1.027e-2435.00Abhydrolase domain-containing protein 4 OS=Homo sa... [more]
YE63_SCHPO2.369e-2140.60Uncharacterized protein C6G10.03c OS=Schizosacchar... [more]
ICT1_YEAST2.147e-1425.581-acylglycerol-3-phosphate O-acyltransferase ICT1 ... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit 24 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004564_F02 Developing fruit 24 DAFB Citrus sinensis cDNA clone T24DAB0001_IIIF_F02 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK935201 ID=CK935201|Name=CK935201|organism=Citrus sinensis|type=EST|length=821bp
GGGGGGGTTCCNNNATAATTATCGATAATTGATTCACCGGCACTGTTCCT
GCTCAGCAATCGTTTACCCAAATTGTATGAATCTGCGGGGGTCAAGCTCA
ATTCCGAAAATGGCAGAAGAAATTAGCAAGAGCGAGCTAAGATCCTCTGC
TGCTGCCACATCAACACCATCATCATCTACGACTGCAAAATCGAGATGGT
CCTGGCCGTCCGTCCTCCGTTGGATTCCCACTTCTACCAATCACATCATT
GCCGCCGAAAAGCGCCTTCTCTCTATAATCAAGACTCCATATGTTCAAGA
ACAAGTTAATATAGGTTCAAGTCCACCTGGGTCGAAAATCAGGTGGTTTC
GTTCTTCAAGCGATGAACCAAGGTTCATCAACACGGTTACTTTTGATAGC
AAAGAGGATTCTCCCACTCTCATAATGGTTCATGGATATGGAGCATCTCA
GGGCTTCTTCTTTCGCAATTTTGATGCTCTTGCTAGTCGTTTCAGAGTAA
TTGCTATTGATCAACTTGGTTGCGGTGGATCAAGTAGGCCTGACTTTACG
TGCAAAAGCACAGAAGAAACTGAAGCATGGTTTATTGATTCCTTTGAGGA
ATGGCGCAAAGCCAAAAACCTCAGCAACTTCATTTTACTTGGGCATTCTC
TTGGAGGGTATGTTGCCGCTAAATATGCTCTCAAGCATCCCGAGCATGTC
CAGCACTTGATTTTAGTTGGACCTGCTGGATTTTCAGCTCAATCAGATGC
CAAATCTGAGTGGATTACCAAGTTCAGGGCAACATGGAAAAGAGCAATTT
TGAACCACTTGTGGGAATCTA
back to top