CK935208

Overview
NameCK935208
Unique NameCK935208
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length862
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1774 contig Csv1_Contig1774:1..862. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK935208 vs. ExPASy Swiss-Prot
Match: DI194_ARATH (Protein DEHYDRATION-INDUCED 19 homolog 4 OS=Arabidopsis thaliana GN=DI19-4 PE=1 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 9.330e-40
Identity = 83/178 (46.63%), Postives = 115/178 (64.61%), Query Frame = 2
Query:  239 EYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVTMDMVDHITTQHGNISNSWHKLKLHKGNSNSTISSLRKELQNAHFQSLLAGXXXXXXXXXXXXDPWL-SFIYNMPTADEPESIQPALSTGEGAEDKSSCEKTFETNAQQSSLSNEDHLEKANRSNFAQGLLFSTIMDD 769
            E+ CPFC+EDFD+VGLCCHIDEEHPVEAK+GVCPVC  RV +D+V HITTQH N      + +L +G  +ST  +L+KEL+ A+ QSLL G            DP L SF++N P+ ++  +      T   A  K S +++ + + Q++ LS ED  EKA +S F +GLL ST+++D
Sbjct:   46 EFICPFCAEDFDIVGLCCHIDEEHPVEAKNGVCPVCTKRVGLDIVGHITTQHANFFKVQRRRRLRRGGYSSTYLALKKELREANLQSLLGGSSSFTSSTNIDSDPLLSSFMFNSPSVNQSANKSATPVTVGNAATKVSIKESLKRDIQEAPLSGEDQ-EKAKKSEFVRGLLLSTMLED 222          
BLAST of CK935208 vs. ExPASy Swiss-Prot
Match: DI193_ARATH (Protein DEHYDRATION-INDUCED 19 homolog 3 OS=Arabidopsis thaliana GN=DI19-3 PE=1 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 1.945e-37
Identity = 85/182 (46.70%), Postives = 110/182 (60.44%), Query Frame = 2
Query:  239 EYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVTMDMVDHITTQHGNISNSWHKLKLHKGNSNSTISSLRKELQNAHFQSLLAG---XXXXXXXXXXXXDPWLSFIYNMPTADEPESIQPALSTGEGAEDKSSCEKTFETNAQQSSLSNEDHLEKANRSNFAQGLLFSTIMDDGL 775
            E+ CPFCS+ FD+V LCCHIDE+HP+EAK+GVCPVC  RV +DMV HIT QH NI     K K  +G S ST+S LR+E  + +FQSL  G               DP LS   + P AD   + +  +S   G   K++ +   E NA+++SLS EDH +K  RS F + LL STI+DD L
Sbjct:   43 EFACPFCSDYFDIVSLCCHIDEDHPMEAKNGVCPVCAVRVGVDMVAHITLQHANIFKMHRKRKPRRGGSYSTLSILRREFPDGNFQSLFGGSSCIVSSSSSSNVAADPLLSSFIS-PIADGFFTTESCISAETGPVKKTTIQCLPEQNAKKTSLSAEDHKQKLKRSEFVRELLSSTILDDSL 223          
BLAST of CK935208 vs. ExPASy Swiss-Prot
Match: DI196_ARATH (Protein DEHYDRATION-INDUCED 19 homolog 6 OS=Arabidopsis thaliana GN=DI19-6 PE=1 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 5.298e-35
Identity = 76/181 (41.99%), Postives = 107/181 (59.12%), Query Frame = 2
Query:  239 EYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVTMDMVDHITTQHGNISNSWHKLKLHKGNSNSTISSLRKELQNAHFQSLLAG--XXXXXXXXXXXXDPWLSFIYNMPTADEPESIQPALSTGEGAEDKSSCEKTFETNAQQSSLSNEDHLEKANRSNFAQGLLFSTIMDDGL 775
            EY CPFCS+ FD+V LCCHIDE+HP++AK+GVCP+C  +V+ DM+ HIT QH N+     K K  +G + S +S L++E  + +FQSL  G              DP LS   + P AD+    + +L     +  K+  +   E N ++ SLS EDH EK  +S F QG+L S I++DGL
Sbjct:   43 EYACPFCSDYFDIVSLCCHIDEDHPMDAKNGVCPICAVKVSSDMIAHITLQHANMFKVTRKRKSRRGGAQSMLSILKREFPDGNFQSLFEGTSRAVSSSSASIAADPLLSSFIS-PMADDFFISESSLCADTSSAKKTLNQSLPERNVEKQSLSAEDHREKLKQSEFVQGILSSMILEDGL 222          
BLAST of CK935208 vs. ExPASy Swiss-Prot
Match: DI197_ARATH (Protein DEHYDRATION-INDUCED 19 homolog 7 OS=Arabidopsis thaliana GN=DI19-7 PE=1 SV=2)

HSP 1 Score: 147.902 bits (372), Expect = 6.919e-35
Identity = 80/178 (44.94%), Postives = 112/178 (62.92%), Query Frame = 2
Query:  239 EYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVTMDMVDHITTQHGNISNSWHKLKLHKGNSNSTISSLRKELQNAHFQSLLAGXXXXXXXXXXXXDPWL-SFIYNMPTADEPESIQPALSTGEGAEDKSSCEKTFETNAQQSSLSNEDHLEKANRSNFAQGLLFSTIMDD 769
            E+ CPFC+++FD+VGLCCHID  HPVEAK+GVCPVC  +V +D+V HITTQHGN+     + +L KG  +ST  +L+KEL+ A+ QS L G            DP L SF++  P+A         ++ G+     S  + T ++  QQ S SNED  EKA +S F +GLL+ST+++D
Sbjct:   42 EFMCPFCADEFDIVGLCCHIDVNHPVEAKNGVCPVCTKKVGLDIVGHITTQHGNVFKVQRRRRLRKGGYSSTYLTLKKELREANLQS-LGGSSTFIPSSNIDSDPLLSSFMFKPPSA-------IPITEGDSVAQVSP-KDTSKSKIQQESFSNEDQ-EKAKKSKFVRGLLWSTMLED 209          
BLAST of CK935208 vs. ExPASy Swiss-Prot
Match: DI192_ORYSJ (Protein DEHYDRATION-INDUCED 19 homolog 2 OS=Oryza sativa subsp. japonica GN=DI19-2 PE=2 SV=2)

HSP 1 Score: 141.739 bits (356), Expect = 4.959e-33
Identity = 75/183 (40.98%), Postives = 105/183 (57.38%), Query Frame = 2
Query:  230 GEYEYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVTMDMVDHITTQHGNISNSWHKLKLHK--GNSNSTISSLRKELQNAHFQSLLAGXXXXXXXXXXXXDPWL-SFIYNMPTADEPESIQPALSTGEGAEDKSSCEKTFETNAQQSSLSNEDHLEKANRSNFAQGLLFSTIMDD 769
            G   Y CPFC EDFD V  CCH+D+EH VEAKSGVCP+C TRV +D++ H+T QHG+      + ++ K    S+S +S LRK+L++   QS L G            DP+L S I ++P A+  + +    S      +K   +KT E    + SLS +D  E+A RS F +GL+ STI +D
Sbjct:   50 GGEAYNCPFCGEDFDFVAFCCHVDDEHAVEAKSGVCPICATRVGVDLIGHLTMQHGSYFKMQRRRRVRKISSGSHSLLSLLRKDLRDGSLQSFLGGSSYVSNPPAAAPDPFLSSLICSLPVAEPSKDLHSDSSDNNFLLNKFPDDKTAE--RAEPSLSEKDQKERAQRSKFVRGLVLSTIFED 230          
BLAST of CK935208 vs. ExPASy Swiss-Prot
Match: DI195_ARATH (Protein DEHYDRATION-INDUCED 19 homolog 5 OS=Arabidopsis thaliana GN=DI19-5 PE=1 SV=2)

HSP 1 Score: 134.806 bits (338), Expect = 6.062e-31
Identity = 78/180 (43.33%), Postives = 104/180 (57.78%), Query Frame = 2
Query:  239 EYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVTMDMVDHITTQHGNISNSWHKLKLHKGNSNSTISSLRKELQNAHFQSLLAGXXXXXXXXXXXXDPWLSFIYNMPTADEPESIQPALSTGEGAEDKS----SCEKTFETNAQQSSLSNEDHLEKANRSNFAQGLLFSTIMD 766
            +YPCPFCS+D+DLV LC HIDEEH ++A +G+CPVC  RV M MVDHITTQH ++       +L+K  S S  S   ++    + QSL+              DP LSFIYN P+  + + +QP  S+    ED S    S EK +E+    S LS+ + LEKA +  F QGL+ S I D
Sbjct:   42 DYPCPFCSDDYDLVELCHHIDEEHQLDANNGICPVCSRRVKMHMVDHITTQHRDVFK-----RLYKDESYSAFSPGTRK----YLQSLIDEPLSTNHTSKSVLDPLLSFIYNPPSPKKSKLVQPDSSSEASMEDNSLIRDSTEKDWES---PSPLSDTELLEKAKKREFVQGLISSAIFD 209          
BLAST of CK935208 vs. ExPASy Swiss-Prot
Match: DI191_ARATH (Protein DEHYDRATION-INDUCED 19 OS=Arabidopsis thaliana GN=DI19-1 PE=1 SV=2)

HSP 1 Score: 117.087 bits (292), Expect = 1.308e-25
Identity = 70/178 (39.33%), Postives = 96/178 (53.93%), Query Frame = 2
Query:  239 EYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVTMDMVDHITTQHGNISNSWHKLKLHKGNSNSTISSLRKELQNAHFQSLLA-GXXXXXXXXXXXXDPWLSFIYNMPTADEPESIQPALSTGEGAEDKSSCEKTFETNAQQSSLSNEDHLEKANRSNFAQGLLFSTIMDD 769
            E+ CPFC+E +D++GLCCHID+EH +E+K+ VCPVC  +V +D+V HIT  HG++     K K  K  +NST+S LRKEL+    Q LL               DP LS   + PT    +S      T   +EDK    K        S +S +D  E+ ++S F Q LL S I D+
Sbjct:   34 EFACPFCAESYDIIGLCCHIDDEHTLESKNAVCPVCSLKVGVDIVAHITLHHGSLFKLQRKRKSRKSGTNSTLSLLRKELREGDLQRLLGFTSRNGSVASSVTPDPLLSSFIS-PT--RSQSSPAPRQTKNVSEDKQIERK---RQVFISPVSLKDREERRHKSEFVQRLLSSAIFDE 205          
BLAST of CK935208 vs. ExPASy Swiss-Prot
Match: DI192_ARATH (Protein DEHYDRATION-INDUCED 19 homolog 2 OS=Arabidopsis thaliana GN=DI19-2 PE=1 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 2.914e-25
Identity = 75/217 (34.56%), Postives = 104/217 (47.93%), Query Frame = 2
Query:  125 STSSSRNYQSTLKSQFAXXXXXXXXXXXXXXXXVKGEYEYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVTMDMVDHITTQHGNISNSWHKLKLHKGNSNSTISSLRKELQNAHFQSLLAGXXXXXXXXXXXXDPWLSFIYNMPTADEPESIQPALSTGEGAEDKSSCEKTFETNAQQSS--LSNEDHLEKANRSNFAQGLLFSTIMDD 769
            S+ SSR+Y+S   +++                 +    EYPCPFC+ D+DLV LC HIDEEH  EA +G+CPVC  RV M MVDHIT+ H ++  S  K   ++ +       L  +    H   L               D +LSFI N    ++ + + P  S     EDK+  + +       SS  LS+ D LEKA +  F QGLL S + DD
Sbjct:   10 SSGSSRSYRSETAAKYQSGPYQDLEEFEEVDDDIA--VEYPCPFCASDYDLVELCHHIDEEHRHEANNGICPVCSKRVKMHMVDHITSHHRDVLKSEQKEMSYRED-----PYLSDKYLQPHLDELPPSMNHHQHPSKHVSDQFLSFINNSALPNQTKLVLPDSS----VEDKNPIKDSSAAKEGTSSCPLSDSDKLEKAKKCEFVQGLLSSAMFDD 215          
BLAST of CK935208 vs. ExPASy Swiss-Prot
Match: DI191_ORYSJ (Protein DEHYDRATION-INDUCED 19 OS=Oryza sativa subsp. japonica GN=DI19-1 PE=2 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.354e-22
Identity = 61/186 (32.80%), Postives = 95/186 (51.08%), Query Frame = 2
Query:  239 EYPCPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVTMDMVDHITTQHGNISNSWHKLKLHKGNSNSTISSLRKELQNAHFQSLLAG----XXXXXXXXXXXXDPWL-SFIYNMPTADEPESIQPALSTGEGAEDKSSCEKTFETNAQQSSLSNEDHLEKAN----RSNFAQGLLFSTIMDD 769
            E+ CP+C ED D+V LC H++EEHP E  +  CP+C  ++  DM++HIT QHG +  +  +L+      +  +S L ++L+ AH Q LL G                DP L SF  + PT+D  E+ +P +S  + A            ++  SSL+ E+  +K      R+ F Q LL +T+  D
Sbjct:   41 EFACPYCYEDHDVVSLCAHLEEEHPFEPHAAPCPICSDKIAKDMLNHITVQHGYLFKNRRRLRRFVIPGSQALSLLSRDLREAHLQVLLGGGGHRSNNSSNTTNISADPLLSSFGLSFPTSDTEETSKPPISIPDDASVIKETPAQPWDSSIDSSLTREEREQKRKQASVRATFVQDLLLTTLFGD 226          
BLAST of CK935208 vs. ExPASy Swiss-Prot
Match: DI193_ORYSJ (Protein DEHYDRATION-INDUCED 19 homolog 3 OS=Oryza sativa subsp. japonica GN=DI19-3 PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.822e-20
Identity = 59/184 (32.07%), Postives = 96/184 (52.17%), Query Frame = 2
Query:  248 CPFCSEDFDLVGLCCHIDEEHPVEAKSGVCPVCVTRVTMDMVDHITTQHGNISNSWHKLKLHKGNSNSTISSLRKELQNAHFQSLLAG----XXXXXXXXXXXXDPWL-SFIYNMPTAD-EPESIQPALSTGEGAEDKSSCEKTFETNAQQSSLSNEDHLEK----ANRSNFAQGLLFSTIMDD 769
            CP+C ED D+  LC H++E+HP E  +  CP+C  ++T DM++HIT QHG +  S  +++      +  +S L ++L++A  Q+LL G                DP L SF     T D E  S  P     + +  K +  + +E+    SSL++E+  +K     +R+ F QGL+ ST+ +D
Sbjct:   64 CPYCYEDHDIASLCAHLEEDHPYEPHTSPCPICFEKITRDMLNHITMQHGYLFKSGRRMRRFDIPESQALSLLSRDLRDAQLQALLGGGHRQRRSNTTATNISADPLLSSFGLGFSTLDSEERSKAPVPIPDDTSIHKDTPAQPWESRI-DSSLTSEEREQKRKQATDRATFVQGLVLSTLFED 246          
The following BLAST results are available for this feature:
BLAST of CK935208 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
DI194_ARATH9.330e-4046.63Protein DEHYDRATION-INDUCED 19 homolog 4 OS=Arabid... [more]
DI193_ARATH1.945e-3746.70Protein DEHYDRATION-INDUCED 19 homolog 3 OS=Arabid... [more]
DI196_ARATH5.298e-3541.99Protein DEHYDRATION-INDUCED 19 homolog 6 OS=Arabid... [more]
DI197_ARATH6.919e-3544.94Protein DEHYDRATION-INDUCED 19 homolog 7 OS=Arabid... [more]
DI192_ORYSJ4.959e-3340.98Protein DEHYDRATION-INDUCED 19 homolog 2 OS=Oryza ... [more]
DI195_ARATH6.062e-3143.33Protein DEHYDRATION-INDUCED 19 homolog 5 OS=Arabid... [more]
DI191_ARATH1.308e-2539.33Protein DEHYDRATION-INDUCED 19 OS=Arabidopsis thal... [more]
DI192_ARATH2.914e-2534.56Protein DEHYDRATION-INDUCED 19 homolog 2 OS=Arabid... [more]
DI191_ORYSJ1.354e-2232.80Protein DEHYDRATION-INDUCED 19 OS=Oryza sativa sub... [more]
DI193_ORYSJ2.822e-2032.07Protein DEHYDRATION-INDUCED 19 homolog 3 OS=Oryza ... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit 24 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004564_E05 Developing fruit 24 DAFB Citrus sinensis cDNA clone T24DAB0001_IIIF_E05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK935208 ID=CK935208|Name=CK935208|organism=Citrus sinensis|type=EST|length=862bp
GGGGGAGCGCTTAAAATCAAAGGGGAAGTTTACTCGCTATTTTATGCTAT
CATCTGAATTGGGTTTTGTTTGTGAATTTTAATTAACAGAAGATTCAATG
GATTACAGTAGATACTTTGGTCTTTCTACTTCATCATCAAGGAACTATCA
GTCAACTCTCAAGTCTCAGTTTGCGGATTTTTGCATTGATTTTGAGGATA
TAGAAGAAGATGATTATGAGGAAGTGAAAGGAGAGTATGAGTATCCATGC
CCATTTTGTTCGGAGGATTTTGATTTAGTTGGATTATGCTGTCATATTGA
TGAGGAACATCCTGTTGAAGCAAAGTCGGGGGTATGCCCTGTTTGCGTTA
CAAGGGTAACGATGGACATGGTTGATCACATAACAACACAACATGGAAAC
ATTTCAAATAGTTGGCACAAATTAAAACTTCATAAAGGCAACTCTAATTC
AACTATATCATCTTTGAGGAAAGAGTTGCAAAATGCACATTTTCAATCTC
TTCTTGCAGGGTCATCCTCTTCTGTTTCTTCCTCCAAAAAGACATCTGAT
CCATGGCTATCATTTATTTACAACATGCCTACTGCTGACGAGCCTGAAAG
CATACAGCCTGCTTTGAGCACTGGAGAAGGAGCAGAAGATAAAAGCTCGT
GTGAGAAAACATTTGAAACAAATGCTCAGCAATCTTCCTTGTCAAACGAG
GACCATTTGGAGAAGGCAAACAGGAGCAATTTTGCACAGGGACTATTATT
TTCTACCATCATGGATGATGGCTTATAAATGATATCAGTGGGGCTGTGGT
TGTCAACTTTAAATTCCGAAGACTAGTTCACAGTTGACATTATCTTATTC
GTATGTGCCAAT
back to top