CK935219

Overview
NameCK935219
Unique NameCK935219
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length769
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1778 contig Csv1_Contig1778:1..772. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK935219 vs. ExPASy Swiss-Prot
Match: SMD2_DROME (Probable small nuclear ribonucleoprotein Sm D2 OS=Drosophila melanogaster GN=snRNP2 PE=1 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 2.056e-40
Identity = 79/88 (89.77%), Postives = 84/88 (95.45%), Query Frame = 1
Query:  145 TGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCDMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMFLRGDSVIIVLRNP 408
            TGPLSVL  SVKNNTQVLINCRNNKKLLGRV+AFDRHC+MVLENV+EMWTELP+TGKGKKK  PVNKDRFISKMFLRGDSVI+VLRNP
Sbjct:   25 TGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTELPRTGKGKKKVKPVNKDRFISKMFLRGDSVILVLRNP 112          
BLAST of CK935219 vs. ExPASy Swiss-Prot
Match: SMD2_MOUSE (Small nuclear ribonucleoprotein Sm D2 OS=Mus musculus GN=Snrpd2 PE=2 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 7.813e-40
Identity = 77/88 (87.50%), Postives = 85/88 (96.59%), Query Frame = 1
Query:  145 TGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCDMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMFLRGDSVIIVLRNP 408
            TGPLSVL  SVKNNTQVLINCRNNKKLLGRV+AFDRHC+MVLENV+EMWTE+PK+GKGKKK+ PVNKDR+ISKMFLRGDSVI+VLRNP
Sbjct:   26 TGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNP 113          
BLAST of CK935219 vs. ExPASy Swiss-Prot
Match: SMD2_HUMAN (Small nuclear ribonucleoprotein Sm D2 OS=Homo sapiens GN=SNRPD2 PE=1 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 7.813e-40
Identity = 77/88 (87.50%), Postives = 85/88 (96.59%), Query Frame = 1
Query:  145 TGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCDMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMFLRGDSVIIVLRNP 408
            TGPLSVL  SVKNNTQVLINCRNNKKLLGRV+AFDRHC+MVLENV+EMWTE+PK+GKGKKK+ PVNKDR+ISKMFLRGDSVI+VLRNP
Sbjct:   26 TGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNP 113          
BLAST of CK935219 vs. ExPASy Swiss-Prot
Match: SMD2_BOVIN (Small nuclear ribonucleoprotein Sm D2 OS=Bos taurus GN=SNRPD2 PE=3 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 7.813e-40
Identity = 77/88 (87.50%), Postives = 85/88 (96.59%), Query Frame = 1
Query:  145 TGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCDMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMFLRGDSVIIVLRNP 408
            TGPLSVL  SVKNNTQVLINCRNNKKLLGRV+AFDRHC+MVLENV+EMWTE+PK+GKGKKK+ PVNKDR+ISKMFLRGDSVI+VLRNP
Sbjct:   26 TGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNP 113          
BLAST of CK935219 vs. ExPASy Swiss-Prot
Match: SMD2_DICDI (Probable small nuclear ribonucleoprotein Sm D2 OS=Dictyostelium discoideum GN=snrpd2 PE=3 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 1.629e-37
Identity = 74/87 (85.06%), Postives = 82/87 (94.25%), Query Frame = 1
Query:  148 GPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCDMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMFLRGDSVIIVLRNP 408
            GPLS+LM SV NNTQVLIN RNNKKLLGRVRAFDRHC+MVLENV+E+WTE+PKT KGKKKA P+NKDRFISKMFLRGDSVI+VL+NP
Sbjct:   18 GPLSILMDSVNNNTQVLINVRNNKKLLGRVRAFDRHCNMVLENVKEIWTEVPKTAKGKKKAKPINKDRFISKMFLRGDSVILVLKNP 104          
BLAST of CK935219 vs. ExPASy Swiss-Prot
Match: SMD2_CAEEL (Probable small nuclear ribonucleoprotein Sm D2 OS=Caenorhabditis elegans GN=snr-4 PE=1 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.379e-36
Identity = 73/87 (83.91%), Postives = 81/87 (93.10%), Query Frame = 1
Query:  148 GPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCDMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMFLRGDSVIIVLRNP 408
            GPLS+L  SVKNN QVLINCRNNKKLLGRV+AFDRHC+MVLENV+EMWTE+PKTGKGKKKA  V KDRFISKMFLRGDSVI+V++NP
Sbjct:   27 GPLSILTNSVKNNHQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKTGKGKKKAKSVAKDRFISKMFLRGDSVILVVKNP 113          
BLAST of CK935219 vs. ExPASy Swiss-Prot
Match: SMD2_SCHPO (Probable small nuclear ribonucleoprotein Sm D2 OS=Schizosaccharomyces pombe GN=smd2 PE=2 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.382e-28
Identity = 62/87 (71.26%), Postives = 72/87 (82.76%), Query Frame = 1
Query:  148 GPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCDMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMFLRGDSVIIVLRNP 408
            GPLSVL  +VKN+ QVLINCRNNKKLL RV+AFDRH +MVLENV+EMWTE  +T  G KK   +NKDRFISKMFLRGD V++V+R P
Sbjct:   28 GPLSVLQQAVKNHDQVLINCRNNKKLLARVKAFDRHSNMVLENVKEMWTEKKRTASG-KKGKAINKDRFISKMFLRGDGVVLVVRIP 113          
BLAST of CK935219 vs. ExPASy Swiss-Prot
Match: SMD2_YEAST (Small nuclear ribonucleoprotein Sm D2 OS=Saccharomyces cerevisiae GN=SMD2 PE=1 SV=2)

HSP 1 Score: 99.3673 bits (246), Expect = 2.364e-20
Identity = 47/87 (54.02%), Postives = 66/87 (75.86%), Query Frame = 1
Query:  148 GPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCDMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMFLRGDSVIIVLRNP 408
            GP+S++  ++   T V+I+ RNN K++ RV+AFDRHC+MVLENV+E+WTE       KK    +N++RFISK+FLRGDSVI+VL+ P
Sbjct:   29 GPMSLINDAMVTRTPVIISLRNNHKIIARVKAFDRHCNMVLENVKELWTE-------KKGKNVINRERFISKLFLRGDSVIVVLKTP 108          
The following BLAST results are available for this feature:
BLAST of CK935219 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
SMD2_DROME2.056e-4089.77Probable small nuclear ribonucleoprotein Sm D2 OS=... [more]
SMD2_MOUSE7.813e-4087.50Small nuclear ribonucleoprotein Sm D2 OS=Mus muscu... [more]
SMD2_HUMAN7.813e-4087.50Small nuclear ribonucleoprotein Sm D2 OS=Homo sapi... [more]
SMD2_BOVIN7.813e-4087.50Small nuclear ribonucleoprotein Sm D2 OS=Bos tauru... [more]
SMD2_DICDI1.629e-3785.06Probable small nuclear ribonucleoprotein Sm D2 OS=... [more]
SMD2_CAEEL1.379e-3683.91Probable small nuclear ribonucleoprotein Sm D2 OS=... [more]
SMD2_SCHPO1.382e-2871.26Probable small nuclear ribonucleoprotein Sm D2 OS=... [more]
SMD2_YEAST2.364e-2054.02Small nuclear ribonucleoprotein Sm D2 OS=Saccharom... [more]
back to top
Libraries
Library NameType
Developing fruit 24 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004564_D12 Developing fruit 24 DAFB Citrus sinensis cDNA clone T24DAB0001_IIIF_D12 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK935219 ID=CK935219|Name=CK935219|organism=Citrus sinensis|type=EST|length=769bp
GGGGGATCTGAGCTAGCTGAGTGTTTGTCTCGTCGTCCGCCGCAGTTAGG
TTGTCGTTCAGTCTTGGCTTGAAGAAGCAAATTGTCAAACATGAGTCGGC
CGATGGAGGAAGATAATGTCAAAAATGAGGAAGAGGAATTCAACACAGGT
CCACTTTCTGTTTTGATGATGAGTGTTAAAAACAATACCCAGGTGCTTAT
TAACTGTCGGAACAACAAGAAGCTTCTTGGTCGTGTGAGAGCTTTTGATC
GTCACTGCGATATGGTTCTTGAGAATGTCAGGGAGATGTGGACTGAGTTG
CCTAAGACTGGGAAAGGCAAGAAAAAGGCTCTTCCAGTTAACAAGGATAG
ATTCATCAGTAAGATGTTTCTCCGAGGAGATTCTGTGATCATTGTTCTTA
GGAATCCCGAGTGAAGTACACACCTAGCTTGACAGCCTCAGCAATTTTAA
CGAAAGATCTATATGGACAATACTGTTTGTGATGGGTAAAAAATGAGCCA
GCAAGCCTAGATTTGTTTGAAGGATGTTCGCATGGTATTTGTGCAATTGT
GCTGCCAAGTTTGGGAGATTGGTTGGAGTATCTTAGGTGTCCTGACATAA
GGGTGACTTTTTTGGTGTGTTGTAAATTCAATGGACTAGAGATGTTATGG
TGTGTAGCTCTTTACTATTTTCTACTTCTAATGCTCGTTTACTTTTATTA
AAATCTTGATCTGTAATATTGAGCCATAAAAAAAAAAAACAAAAAAAAAA
AAAAAAAAAAAAAAAAAAA
back to top