CK935221

Overview
NameCK935221
Unique NameCK935221
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length847
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1779 contig Csv1_Contig1779:1..847. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK935221 vs. ExPASy Swiss-Prot
Match: FABZ_SYNY3 ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase OS=Synechocystis sp. (strain PCC 6803) GN=fabZ PE=3 SV=2)

HSP 1 Score: 147.902 bits (372), Expect = 6.717e-35
Identity = 77/130 (59.23%), Postives = 99/130 (76.15%), Query Frame = 1
Query:  463 TVMDINQIRDILPHRFPFLLVDRVIEYNPGVSAVAIKNVTINDNFFPGHFPERPIMPGVLMVEAMAQVGGLVMLQPEVGGSRENFF-FAGIDKVRFRKPVIAGDTLVMRMTL--VKLQKRFGIAKMEGKA 843
            T   I +I D+LPHR+PF LVDR+I++ PG  AV +KNVTIN+ FFPGH P+RPIMPGVL+VE+MAQVGG+++ Q  + G R  FF FAGID VRFR+PV+ GD L+M + L   KLQ+   IAKM+G+A
Sbjct:   22 TQFTIQEISDLLPHRYPFALVDRIIDFQPGKCAVGLKNVTINEPFFPGHIPDRPIMPGVLIVESMAQVGGVILTQ--LPGMRGKFFAFAGIDGVRFRRPVVPGDQLIMTVELQSFKLQR---IAKMQGEA 146          
BLAST of CK935221 vs. ExPASy Swiss-Prot
Match: FABZ_MICAN ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase OS=Microcystis aeruginosa (strain NIES-843) GN=fabZ PE=3 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 8.773e-35
Identity = 73/128 (57.03%), Postives = 96/128 (75.00%), Query Frame = 1
Query:  463 TVMDINQIRDILPHRFPFLLVDRVIEYNPGVSAVAIKNVTINDNFFPGHFPERPIMPGVLMVEAMAQVGGLVMLQPEVGGSRENFF-FAGIDKVRFRKPVIAGDTLVMRMTLVKLQKRFGIAKMEGKA 843
            T   + +IR +LPHR+PF LVDR+I+Y PG  AV +KNVTIN+ FFPGH P RP+MPGVL+VE+MAQVGG+++ Q  + G +  FF FAGIDK RFR+PV+ GD L+M + L+   K   IAKM+G+A
Sbjct:   17 TTFTVEEIRQLLPHRYPFALVDRIIDYVPGQKAVGLKNVTINEPFFPGHIPNRPLMPGVLIVESMAQVGGVILTQ--LPGMKGKFFAFAGIDKTRFRRPVVPGDQLIMTVELLSF-KMNKIAKMQGEA 141          
BLAST of CK935221 vs. ExPASy Swiss-Prot
Match: FABZ_SYNSC ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase OS=Synechococcus sp. (strain CC9605) GN=fabZ PE=3 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 5.686e-34
Identity = 77/125 (61.60%), Postives = 96/125 (76.80%), Query Frame = 1
Query:  466 VMDINQIRDILPHRFPFLLVDRVIEYNPGVSAVAIKNVTINDNFFPGHFPERPIMPGVLMVEAMAQVGGLVMLQ-PEVGGSRENFFFAGIDKVRFRKPVIAGDTLVMRMTLVKL-QKRFGIAKME 834
            V+   QI  +LPHR+PF LVDRVI ++PGVSA AIKNVT+N+  F GHFPERP+MPGVL+VEAMAQVGGL++ Q P++   +  F FAGID VRFR+PV+ GD LV+R  L+ L +KRFG  K E
Sbjct:   10 VLTSEQIAGLLPHRYPFALVDRVIAHDPGVSATAIKNVTMNEPQFQGHFPERPLMPGVLIVEAMAQVGGLIVTQMPDL--PKGLFVFAGIDGVRFRRPVVPGDQLVIRCELLSLKRKRFGKVKAE 132          
BLAST of CK935221 vs. ExPASy Swiss-Prot
Match: FABZ_ANAVT ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=fabZ PE=3 SV=2)

HSP 1 Score: 144.436 bits (363), Expect = 7.427e-34
Identity = 76/129 (58.91%), Postives = 97/129 (75.19%), Query Frame = 1
Query:  463 TVMDINQIRDILPHRFPFLLVDRVIEYNPGVSAVAIKNVTINDNFFPGHFPERPIMPGVLMVEAMAQVGGLVMLQ-PEVGGSRENFFFAGIDKVRFRKPVIAGDTLVMRMTLVKL-QKRFGIAKMEGKA 843
            T     +I+ +LPHR+PFLLVD++I+Y PG  AV IKNVTIN+  F GHFP+RP+MPGVL+VEAMAQVGG+VM Q P + G    F FAGIDKVRFR+ V+ GD LVM + L+ + Q+RFG  KM+ +A
Sbjct:   23 TTFTSEEIQKLLPHRYPFLLVDKIIDYTPGKQAVGIKNVTINEPHFTGHFPDRPLMPGVLIVEAMAQVGGIVMTQLPNLEGGL--FVFAGIDKVRFRRQVVPGDQLVMTVELLWIKQRRFG--KMQARA 147          
BLAST of CK935221 vs. ExPASy Swiss-Prot
Match: FABZ_SYNS9 ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase OS=Synechococcus sp. (strain CC9902) GN=fabZ PE=3 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 1.267e-33
Identity = 75/125 (60.00%), Postives = 95/125 (76.00%), Query Frame = 1
Query:  466 VMDINQIRDILPHRFPFLLVDRVIEYNPGVSAVAIKNVTINDNFFPGHFPERPIMPGVLMVEAMAQVGGLVMLQ-PEVGGSRENFFFAGIDKVRFRKPVIAGDTLVMRMTLVKL-QKRFGIAKME 834
            V+   QI  +LPHR+PF LVDRVI Y PGVSA AIKN+T+N+  F GHFPERP+MPGVL+VEAMAQVGGL++ Q P++   +  F FAGID VRFR+PV+ GD L+++  L+ L +KRFG  K E
Sbjct:   10 VLTSEQIAGLLPHRYPFALVDRVIAYEPGVSATAIKNITMNEPQFQGHFPERPLMPGVLIVEAMAQVGGLIVAQIPDL--PKGLFVFAGIDGVRFRRPVVPGDQLIIQCELLSLKRKRFGKIKAE 132          
BLAST of CK935221 vs. ExPASy Swiss-Prot
Match: FABZ_ANASP ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase OS=Anabaena sp. (strain PCC 7120) GN=fabZ PE=3 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 1.267e-33
Identity = 76/129 (58.91%), Postives = 97/129 (75.19%), Query Frame = 1
Query:  463 TVMDINQIRDILPHRFPFLLVDRVIEYNPGVSAVAIKNVTINDNFFPGHFPERPIMPGVLMVEAMAQVGGLVMLQ-PEVGGSRENFFFAGIDKVRFRKPVIAGDTLVMRMTLVKL-QKRFGIAKMEGKA 843
            T     +I+ +LPHR+PFLLVD++I+Y PG  AV IKNVTIN+  F GHFP+RP+MPGVL+VEAMAQVGG+VM Q P + G    F FAGIDKVRFR+ V+ GD LVM + L+ + Q+RFG  KM+ +A
Sbjct:   29 TTFTSEEIQKLLPHRYPFLLVDKIIDYTPGKQAVGIKNVTINEPHFTGHFPDRPLMPGVLIVEAMAQVGGIVMTQLPGLEGGL--FVFAGIDKVRFRRQVVPGDQLVMTVELLWIKQRRFG--KMQARA 153          
BLAST of CK935221 vs. ExPASy Swiss-Prot
Match: FABZ_THEEB ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase OS=Thermosynechococcus elongatus (strain BP-1) GN=fabZ PE=3 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 1.654e-33
Identity = 71/127 (55.91%), Postives = 98/127 (77.17%), Query Frame = 1
Query:  463 TVMDINQIRDILPHRFPFLLVDRVIEYNPGVSAVAIKNVTINDNFFPGHFPERPIMPGVLMVEAMAQVGGLVMLQPEVGGSRENFFFAGIDKVRFRKPVIAGDTLVMRMTLVKLQKRFGIAKMEGKA 843
            TV+ + +++ +LPHR+PFLLVDR+I+Y P   AV +KNVTIN+ FF GHFP RPIMPGVL+VEA+AQVGG+V++Q      + +  FAGIDKVRFR+PV+ GD L++R  L+ + K+  I KM+G+A
Sbjct:   11 TVLTVTELQQLLPHRYPFLLVDRIIDYVPEKYAVGLKNVTINEPFFQGHFPGRPIMPGVLIVEALAQVGGVVLMQMNWAKDKLS-VFAGIDKVRFRRPVVPGDQLILRAELL-VVKQQRIGKMQGRA 135          
BLAST of CK935221 vs. ExPASy Swiss-Prot
Match: FABZ_SYNJA ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase OS=Synechococcus sp. (strain JA-3-3Ab) GN=fabZ PE=3 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 2.822e-33
Identity = 73/122 (59.84%), Postives = 91/122 (74.59%), Query Frame = 1
Query:  460 PTVMDINQIRDILPHRFPFLLVDRVIEYNPGVSAVAIKNVTINDNFFPGHFPERPIMPGVLMVEAMAQVGGLVMLQ-PEVGGSRENFFFAGIDKVRFRKPVIAGDTLVMRMTLVKL-QKRFG 819
            P V   +QI +ILPHR+PFLLVDRV+EY PG  AV +KNVT N+ FF GHFP RPIMPGVL+VEAMAQ+GG+V+ + P+V G      FAGID VRFR+PV+ GD L++   L+ + QKR G
Sbjct:   23 PPVFTTDQILEILPHRYPFLLVDRVVEYQPGQRAVGLKNVTFNEPFFQGHFPNRPIMPGVLIVEAMAQLGGIVLTKLPDVAGRLA--LFAGIDGVRFRRPVLPGDQLLLSANLLTIRQKRIG 142          
BLAST of CK935221 vs. ExPASy Swiss-Prot
Match: FABZ_PROMA ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase OS=Prochlorococcus marinus GN=fabZ PE=3 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 3.686e-33
Identity = 73/129 (56.59%), Postives = 94/129 (72.87%), Query Frame = 1
Query:  460 PTVMDINQIRDILPHRFPFLLVDRVIEYNPGVSAVAIKNVTINDNFFPGHFPERPIMPGVLMVEAMAQVGGLVMLQ-PEVGGSRENFFFAGIDKVRFRKPVIAGDTLVMRMTLVKLQK-RFGIAKMEGK 840
            P V+   +I  +LPHR+PF LVDRV+EY PG SA  IKNVTIN+  F GHFP RP+MPGVL+VEAMAQVGGL++ Q P++   +  F FAGID VRFR+PV+ GD L++   L+ +++ RFG  K E K
Sbjct:    8 PVVLTNEEIMGLLPHRYPFALVDRVVEYEPGKSATGIKNVTINEPHFQGHFPGRPLMPGVLIVEAMAQVGGLIVKQIPDL--PKGLFVFAGIDSVRFRRPVVPGDQLLINCELISIKRQRFGKVKGEAK 134          
BLAST of CK935221 vs. ExPASy Swiss-Prot
Match: FABZ_SYNJB ((3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase OS=Synechococcus sp. GN=fabZ PE=3 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 4.814e-33
Identity = 70/119 (58.82%), Postives = 89/119 (74.79%), Query Frame = 1
Query:  460 PTVMDINQIRDILPHRFPFLLVDRVIEYNPGVSAVAIKNVTINDNFFPGHFPERPIMPGVLMVEAMAQVGGLVMLQ-PEVGGSRENFFFAGIDKVRFRKPVIAGDTLVMRMTLVKLQKR 813
            P V    QI +ILPHR+PFLLVDRV+EY PG  AV +KNVT N+ FF GHFP RPIMPGVL+VEAMAQ+GG+V+ + P+V G      FAGID VRFR+PV+ GD L++   L+ +++R
Sbjct:   23 PPVFTTEQILEILPHRYPFLLVDRVVEYQPGQRAVGLKNVTFNEPFFQGHFPNRPIMPGVLIVEAMAQIGGIVLTKLPDVAGRLA--LFAGIDGVRFRRPVLPGDQLLLSADLLTIRQR 139          
The following BLAST results are available for this feature:
BLAST of CK935221 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
FABZ_SYNY36.717e-3559.23(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehyd... [more]
FABZ_MICAN8.773e-3557.03(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehyd... [more]
FABZ_SYNSC5.686e-3461.60(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehyd... [more]
FABZ_ANAVT7.427e-3458.91(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehyd... [more]
FABZ_SYNS91.267e-3360.00(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehyd... [more]
FABZ_ANASP1.267e-3358.91(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehyd... [more]
FABZ_THEEB1.654e-3355.91(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehyd... [more]
FABZ_SYNJA2.822e-3359.84(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehyd... [more]
FABZ_PROMA3.686e-3356.59(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehyd... [more]
FABZ_SYNJB4.814e-3358.82(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehyd... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit 24 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004564_E02 Developing fruit 24 DAFB Citrus sinensis cDNA clone T24DAB0001_IIIF_E02 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK935221 ID=CK935221|Name=CK935221|organism=Citrus sinensis|type=EST|length=847bp
GGGGGCTTTACACAGTACAACTTTTGCCAACACCCAATCCCATCATTGGT
CTCTCCTACTAGTACCCATAGACTATCTCGTTAATGTCGCCGCCGACCAA
CTGTCATGGGTTTGATTTAAATGTCTATTCTTACATCTCTGCCTCATTTT
ATTAGTTAACTTATTACTCCTCAATTGAATCAATAGAATCCAATCTCTCA
GTTCTTCTCTCTTACAATGGCTACTACCCCTGCTGCTTCCTTTGCCAATT
CACTTTTATCTCTCAATTCTCATCGACCAAATCCAAATGCCTCTTCTATT
TCAAAACCCAACACTCTCTCCATCCAATTCGACAAGAAGACGAATCAACA
ACAACAGCAGCACCAACGACATGCTCGTTTCACCACATTTTGTTCTTTGG
ACGCTGAACCCAAAGATTCCATCGAAGATAGACCCATCGAACTTCGGTAC
CAGGCATTTCCTACAGTGATGGACATTAACCAGATTCGTGACATTTTGCC
ACACAGGTTCCCATTTCTTTTGGTGGATAGAGTTATTGAATACAATCCAG
GAGTTTCAGCTGTTGCTATTAAGAATGTTACTATTAATGATAACTTCTTT
CCTGGCCATTTTCCTGAGAGGCCAATTATGCCCGGTGTTCTCATGGTTGA
GGCAATGGCACAGGTTGGTGGCTTGGTTATGCTGCAACCAGAAGTGGGAG
GCTCTCGTGAAAATTTCTTCTTTGCTGGAATTGATAAAGTAAGATTCAGG
AAACCAGTGATTGCAGGTGACACTTTGGTCATGAGAATGACACTTGTCAA
GCTACAGAAACGCTTCGGAATAGCAAAGATGGAAGGGAAAGCTTATG
back to top