CK935222

Overview
NameCK935222
Unique NameCK935222
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length882
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9253 contig Csv1_Contig9253:1..878. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK935222 vs. ExPASy Swiss-Prot
Match: CHS2_CITSI (Chalcone synthase 2 OS=Citrus sinensis GN=CHS2 PE=2 SV=1)

HSP 1 Score: 517.694 bits (1332), Expect = 3.441e-146
Identity = 261/275 (94.91%), Postives = 261/275 (94.91%), Query Frame = 3
Query:   57 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSGITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXXPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTXHLLKDVPGLI 881
            MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCS ITAVTFRGPADTHLDSLVGQALF            PDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLT HLLKDVPGLI
Sbjct:    1 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAVIVGADPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTFHLLKDVPGLI 275          
BLAST of CK935222 vs. ExPASy Swiss-Prot
Match: CHS3_RUTGR (Chalcone synthase 3 OS=Ruta graveolens GN=CHS3 PE=2 SV=1)

HSP 1 Score: 486.493 bits (1251), Expect = 8.495e-137
Identity = 242/273 (88.64%), Postives = 251/273 (91.94%), Query Frame = 3
Query:   63 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSGITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXXPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTXHLLKDVPGLI 881
            TV+EIR AQRADGPATVLAIGTATPA+ V QADYPDYYFRITKSEHMT+LKEKFKRMCDKSMI+KRYM+LTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPG DYQLTKL+GLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN+GARVLVVCS ITAVTFRGP DTHLDSLVGQALF            PD S+ERPLYQLVS +QTILPDSDGAIDGHLREVGLT HLLKDVPGLI
Sbjct:    5 TVEEIRKAQRADGPATVLAIGTATPANYVTQADYPDYYFRITKSEHMTDLKEKFKRMCDKSMIRKRYMHLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAAKAIKEWGQPKSKITHLIFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPVDTHLDSLVGQALFGDGAAAVIVGADPDESIERPLYQLVSAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLI 277          
BLAST of CK935222 vs. ExPASy Swiss-Prot
Match: CHS2_RUTGR (Chalcone synthase 2 OS=Ruta graveolens GN=CHS2 PE=2 SV=1)

HSP 1 Score: 486.108 bits (1250), Expect = 1.109e-136
Identity = 242/273 (88.64%), Postives = 251/273 (91.94%), Query Frame = 3
Query:   63 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSGITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXXPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTXHLLKDVPGLI 881
            TV+EIR AQRADGPA VLAIGTATPA+ V QADYPDYYFRITKSEHMTELKEKFKRMCDKSMI+KRYMYLTE+ILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPG DYQLTKL+GLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN+GARVLVVCS ITAVTFRGPADTHLDSLVGQALF            P+ S+ERPLYQLVS +QTILPDSDGAIDGHLREVGLT HLLKDVPGLI
Sbjct:    5 TVEEIRKAQRADGPAAVLAIGTATPANYVTQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIRKRYMYLTEDILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAVIVGADPNESIERPLYQLVSAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLI 277          
BLAST of CK935222 vs. ExPASy Swiss-Prot
Match: CHS1_RUTGR (Chalcone synthase 1 OS=Ruta graveolens GN=CHS1 PE=2 SV=1)

HSP 1 Score: 483.797 bits (1244), Expect = 5.506e-136
Identity = 241/273 (88.28%), Postives = 250/273 (91.58%), Query Frame = 3
Query:   63 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSGITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXXPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTXHLLKDVPGLI 881
            TV+ IR AQRADGPA VLAIGTATPA+ V QADYPDYYFRITKSEHMTELKEKFKRMCDKSMI+KRYM+LTE+ILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHLIFCTTSGVDMPG DYQLTKL+GLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENN+GARVLVVCS ITAVTFRGPADTHLDSLVGQALF            PD S+ERPLYQLVS +QTILPDSDGAIDGHLREVGLT HLLKDVPGLI
Sbjct:    5 TVEAIRKAQRADGPAAVLAIGTATPANYVTQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIRKRYMHLTEDILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAAVKAIKEWGQPKSKITHLIFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPADTHLDSLVGQALFGDGAAAVIVGADPDESIERPLYQLVSAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLI 277          
BLAST of CK935222 vs. ExPASy Swiss-Prot
Match: CHSY_BETVE (Chalcone synthase OS=Betula verrucosa GN=CHS PE=2 SV=2)

HSP 1 Score: 481.871 bits (1239), Expect = 2.092e-135
Identity = 238/275 (86.55%), Postives = 251/275 (91.27%), Query Frame = 3
Query:   57 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSGITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXXPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTXHLLKDVPGLI 881
            MA+V+EIR AQRA GPATVLAIGTATP++ + QADYPDYYFRITKS+HMTELKEKFKRMCDKSMIKKRYMYL EEIL ENPNMCAYMAPSLDARQ IVVVEVPKLGKEAATKAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCS ITAVTFRGP DTHLDSLVGQALF            PDTSVERPL++L+S +QTILPDSDGAIDGHLREVGLT HLLKDVPG+I
Sbjct:    1 MASVEEIRKAQRAHGPATVLAIGTATPSNCITQADYPDYYFRITKSDHMTELKEKFKRMCDKSMIKKRYMYLNEEILNENPNMCAYMAPSLDARQTIVVVEVPKLGKEAATKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGADPDTSVERPLFELISAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGII 275          
BLAST of CK935222 vs. ExPASy Swiss-Prot
Match: CHS2_CAMSI (Chalcone synthase 2 OS=Camellia sinensis GN=CHS2 PE=2 SV=1)

HSP 1 Score: 468.389 bits (1204), Expect = 2.394e-131
Identity = 231/275 (84.00%), Postives = 248/275 (90.18%), Query Frame = 3
Query:   57 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSGITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXXPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTXHLLKDVPGLI 881
            M TV+E+R AQRA+GPATV+AIGTATP + V+Q+ YPDYYFRIT SEH TELKEKF+RMCDKSMIKKRYMYLTEEILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAATKAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCS ITAVTFRGP+D HLDSLVGQALF            P   VE+PL++LVS +QTILPDSDGAIDGHLREVGLT HLLKDVPGLI
Sbjct:    1 MVTVEEVRRAQRAEGPATVMAIGTATPPNCVDQSTYPDYYFRITNSEHKTELKEKFQRMCDKSMIKKRYMYLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAATKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAAIIVGSDPIPEVEKPLFELVSAAQTILPDSDGAIDGHLREVGLTFHLLKDVPGLI 275          
BLAST of CK935222 vs. ExPASy Swiss-Prot
Match: CHSY_VITVI (Chalcone synthase OS=Vitis vinifera GN=CHS PE=2 SV=1)

HSP 1 Score: 467.618 bits (1202), Expect = 4.084e-131
Identity = 231/275 (84.00%), Postives = 248/275 (90.18%), Query Frame = 3
Query:   57 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSGITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXXPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTXHLLKDVPGLI 881
            M +V EIR AQRA+GPATVLAIGTATPA+ V QADYPDYYFRIT SEHMTELKEKFKRMC+KSMI KRYM+LTEEILKENPN+CAYMAPSLDARQD+VVVEVPKLGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GL+PSVKR MMYQQGCFAGGTVLRLAKDLAENN G+RVLVVCS ITAVTFRGP+DTHLDSLVGQALF            PDT +E PL++LVS +QTILPDS+GAIDGHLREVGLT HLLKDVPGLI
Sbjct:    1 MVSVAEIRKAQRAEGPATVLAIGTATPANCVYQADYPDYYFRITNSEHMTELKEKFKRMCEKSMINKRYMHLTEEILKENPNVCAYMAPSLDARQDMVVVEVPKLGKEAAAKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLKPSVKRLMMYQQGCFAGGTVLRLAKDLAENNAGSRVLVVCSEITAVTFRGPSDTHLDSLVGQALFGDGAAAVIIGADPDTKIELPLFELVSAAQTILPDSEGAIDGHLREVGLTFHLLKDVPGLI 275          
BLAST of CK935222 vs. ExPASy Swiss-Prot
Match: CHS1_HORVU (Chalcone synthase 1 OS=Hordeum vulgare GN=CHS1 PE=3 SV=1)

HSP 1 Score: 467.618 bits (1202), Expect = 4.084e-131
Identity = 230/273 (84.25%), Postives = 249/273 (91.21%), Query Frame = 3
Query:   63 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSGITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXXPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTXHLLKDVPGLI 881
            TV+E+RNAQRA+GPATVLAIGTATPA+ V QADYPDYYF+ITKS+HM +LKEKFKRMCDKS I+KRYM+LTEEIL+ENPNMCAYMAPSLDARQDIVVVEVPKLGK AA KAIKEWGQP+SKITHL+FCTTSGVDMPGADYQLTK++GLRPSVKR MMYQQGCFAGGTVLRLAKDLAENN+GARVLVVCS ITAVTFRGP ++HLDSLVGQALF            PD SVERPL+QLVS SQTILPDS+GAIDGHLREVGLT HLLKDVPGLI
Sbjct:    6 TVEEVRNAQRAEGPATVLAIGTATPANCVYQADYPDYYFKITKSDHMADLKEKFKRMCDKSQIRKRYMHLTEEILEENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPRSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPHESHLDSLVGQALFGDGAAAVIIGADPDLSVERPLFQLVSASQTILPDSEGAIDGHLREVGLTFHLLKDVPGLI 278          
BLAST of CK935222 vs. ExPASy Swiss-Prot
Match: CHS4_SORBI (Chalcone synthase 4 OS=Sorghum bicolor GN=CHS4 PE=3 SV=1)

HSP 1 Score: 466.463 bits (1199), Expect = 9.097e-131
Identity = 230/273 (84.25%), Postives = 247/273 (90.48%), Query Frame = 3
Query:   63 TVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSGITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXXPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTXHLLKDVPGLI 881
            TV+E+R AQRA GPATVLAIGTATPA+ V+QADYPDYYFRITKSEHMTELKEKFKRMCDKS I+KRYM+LTEE L ENPNMCAYMAPSLDARQDIVVVEVPKLGK AA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTK++GLRPSVKR MMYQQGCFAGGTVLR+AKDLAENN+GARVLVVCS ITAVTFRGP+++HLDS+VGQALF            PD  VERPL+QLVS SQTILPDS+GAIDGHLREVGLT HLLKDVPGLI
Sbjct:    7 TVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTELKEKFKRMCDKSQIRKRYMHLTEEYLAENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVKRLMMYQQGCFAGGTVLRVAKDLAENNRGARVLVVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAVIVGADPDERVERPLFQLVSASQTILPDSEGAIDGHLREVGLTFHLLKDVPGLI 279          
BLAST of CK935222 vs. ExPASy Swiss-Prot
Match: CHSE_IPONI (Chalcone synthase E OS=Ipomoea nil GN=CHSE PE=2 SV=1)

HSP 1 Score: 466.077 bits (1198), Expect = 1.188e-130
Identity = 228/275 (82.91%), Postives = 247/275 (89.82%), Query Frame = 3
Query:   57 MATVQEIRNAQRADGPATVLAIGTATPAHSVNQADYPDYYFRITKSEHMTELKEKFKRMCDKSMIKKRYMYLTEEILKENPNMCAYMAPSLDARQDIVVVEVPKLGKEAATKAIKEWGQPKSKITHLIFCTTSGVDMPGADYQLTKLIGLRPSVKRFMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSGITAVTFRGPADTHLDSLVGQALFXXXXXXXXXXXXPDTSVERPLYQLVSTSQTILPDSDGAIDGHLREVGLTXHLLKDVPGLI 881
            M TV+E+R AQRA GPAT++AIGT+TP + V+Q+ YPDYYFRIT SEH+ ELKEKFKRMC+KSMIKKRYMYLTEEILKENPN+CAYMAPSLDARQDIVVVEVPKLGKEAA KAIKEWGQPKSKITHL+FCTTSGVDMPGADYQLTKL+GL+PSVKRFMMYQQGCFAGGTV+RLAKDLAENNKGARVLVVCS ITAVTFRGP+D HLDSLVGQALF            PD  +ERPL+QLVS +QTILPDS GAIDGHLREVGLT HLLKDVPGLI
Sbjct:    1 MVTVEEVRKAQRAQGPATIMAIGTSTPQNCVDQSTYPDYYFRITNSEHLVELKEKFKRMCEKSMIKKRYMYLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQPKSKITHLVFCTTSGVDMPGADYQLTKLLGLQPSVKRFMMYQQGCFAGGTVIRLAKDLAENNKGARVLVVCSEITAVTFRGPSDAHLDSLVGQALFGDGAAALIIGSDPDPDLERPLFQLVSAAQTILPDSGGAIDGHLREVGLTFHLLKDVPGLI 275          
The following BLAST results are available for this feature:
BLAST of CK935222 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 145
Match NameE-valueIdentityDescription
CHS2_CITSI3.441e-14694.91Chalcone synthase 2 OS=Citrus sinensis GN=CHS2 PE=... [more]
CHS3_RUTGR8.495e-13788.64Chalcone synthase 3 OS=Ruta graveolens GN=CHS3 PE=... [more]
CHS2_RUTGR1.109e-13688.64Chalcone synthase 2 OS=Ruta graveolens GN=CHS2 PE=... [more]
CHS1_RUTGR5.506e-13688.28Chalcone synthase 1 OS=Ruta graveolens GN=CHS1 PE=... [more]
CHSY_BETVE2.092e-13586.55Chalcone synthase OS=Betula verrucosa GN=CHS PE=2 ... [more]
CHS2_CAMSI2.394e-13184.00Chalcone synthase 2 OS=Camellia sinensis GN=CHS2 P... [more]
CHSY_VITVI4.084e-13184.00Chalcone synthase OS=Vitis vinifera GN=CHS PE=2 SV... [more]
CHS1_HORVU4.084e-13184.25Chalcone synthase 1 OS=Hordeum vulgare GN=CHS1 PE=... [more]
CHS4_SORBI9.097e-13184.25Chalcone synthase 4 OS=Sorghum bicolor GN=CHS4 PE=... [more]
CHSE_IPONI1.188e-13082.91Chalcone synthase E OS=Ipomoea nil GN=CHSE PE=2 SV... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit 24 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004564_E03 Developing fruit 24 DAFB Citrus sinensis cDNA clone T24DAB0001_IIIF_E03 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK935222 ID=CK935222|Name=CK935222|organism=Citrus sinensis|type=EST|length=882bp
GGGGCACACTCACCAAGCACGAGCCACAAANNNATTCATTAAGGGTTCAA
CTTGAAATGGCAACCGTTCAAGAGATCAGAAACGCTCAGCGTGCCGACGG
CCCGGCCACCGTCCTCGCCATCGGTACGGCCACGCCTGCCCACAGTGTCA
ACCAGGCTGATTATCCCGACTATTACTTCAGGATCACAAAGAGCGAGCAT
ATGACGGAGCTTAAGGAGAAGTTCAAGCGCATGTGTGACAAGTCGATGAT
TAAGAAGCGTTACATGTACTTAACGGAAGAGATTTTGAAGGAAAACCCCA
ACATGTGCGCTTACATGGCTCCATCACTCGACGCACGTCAAGACATTGTG
GTGGTCGAAGTGCCGAAGCTCGGGAAGGAAGCTGCTACAAAGGCCATCAA
AGAATGGGGCCAGCCCAAGTCTAAGATCACCCACCTCATCTTCTGCACCA
CCTCCGGCGTCGACATGCCCGGCGCCGACTACCAGCTCACCAAACTGATC
GGCCTGCGCCCCTCCGTCAAGCGCTTCATGATGTACCAACAAGGATGTTT
CGCCGGCGGCACTGTTCTTCGCCTCGCTAAAGACTTGGCTGAGAACAACA
AGGGCGCTCGCGTTCTTGTTGTCTGTTCGGGGATCACGGCAGTCACTTTC
CGCGGCCCTGCCGATACTCATCTTGATTCTCTTGTGGGCCAGGCTTTGTT
CGGTGATGGTGCTGCTGCTGTGATCGTGGGTGCCGATCCTGACACGTCGG
TCGAGCGTCCGTTGTATCAGCTCGTGTCGACTTCGCAGACGATCCTCCCT
GACTCTGACGGTGCAATTGACGGACACTTGCGCGAAGTCGGTCTCACNNN
CCATTTGCTTAAAGACGTCCCCGGCTTGATCT
back to top