CK935224

Overview
NameCK935224
Unique NameCK935224
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length840
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CK935224 vs. ExPASy Swiss-Prot
Match: POL3_DROME (Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster GN=pol PE=4 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 1.695e-37
Identity = 84/225 (37.33%), Postives = 134/225 (59.56%), Query Frame = 3
Query:  147 KCCFGVLQVEYLGHLISLVGVAVDPKKIQTVLEWPIPSSTKEVRGFLRLASYYRKFIRGFGGIATPLTRLLTKEGFHWTS--EAESAFTQLKHALTSPHVLRLQDFSQPFVVECDACGVGIGAISSQNDKPVAFFSEALQGSMLVLPTCEKEMLAIVKAIRKWRPYLLGKPFIVRTDQKSLKFLMEQRITTMAQT*WLPKILGYDYTIQCKKRSENRGADALSRL 815
            KC F   +  +LGH+++  G+  +P+KI+ + ++PIP+  KE++ FL L  YYRKFI  F  IA P+T+ L K     T+  E +SAF +LK+ ++   +L++ DF++ F +  DA  V +GA+ SQ+  P+++ S  L    +   T EKE+LAIV A + +R YLLG+ F + +D + L +L   +      T W  K+  +D+ I+  K  EN  ADALSR+
Sbjct:  400 KCEFLKQETTFLGHVLTPDGIKPNPEKIEAIQKYPIPTKPKEIKAFLGLTGYYRKFIPNFADIAKPMTKCLKKNMKIDTTNPEYDSAFKKLKYLISEDPILKVPDFTKKFTLTTDASDVALGAVLSQDGHPLSYISRTLNEHEINYSTIEKELLAIVWATKTFRHYLLGRHFEISSDHQPLSWLYRMKDPNSKLTRWRVKLSEFDFDIKYIKGKENCVADALSRI 624          

HSP 2 Score: 24.2534 bits (51), Expect = 1.695e-37
Identity = 14/45 (31.11%), Postives = 24/45 (53.33%), Query Frame = 1
Query:   34 LVFFNDILVYSKTWADHIFHLKTVLQILSDNSLFKKNQSVVLEFC 168
            LV+ +DI+V+S +  +H+  L  V +      L K N  + L+ C
Sbjct:  362 LVYLDDIIVFSTSLDEHLQSLGLVFE-----KLAKANLKLQLDKC 401          
BLAST of CK935224 vs. ExPASy Swiss-Prot
Match: POL2_DROME (Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster GN=pol PE=4 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 8.283e-37
Identity = 83/225 (36.89%), Postives = 126/225 (56.00%), Query Frame = 3
Query:  147 KCCFGVLQVEYLGHLISLVGVAVDPKKIQTVLEWPIPSSTKEVRGFLRLASYYRKFIRGFGGIATPLTRLLTKEGFHWTSEAE--SAFTQLKHALTSPHVLRLQDFSQPFVVECDACGVGIGAISSQNDKPVAFFSEALQGSMLVLPTCEKEMLAIVKAIRKWRPYLLGKPFIVRTDQKSLKFLMEQRITTMAQT*WLPKILGYDYTIQCKKRSENRGADALSRL 815
            KC F   +  +LGH+++  G+  +P K++ ++ +PIP+  KE+R FL L  YYRKFI  +  IA P+T  L K     T + E   AF +LK  +    +L+L DF + FV+  DA  + +GA+ SQN  P++F S  L    L     EKE+LAIV A + +R YLLG+ F++ +D + L++L   +        W  ++  Y + I   K  EN  ADALSR+
Sbjct:  399 KCEFLKKEANFLGHIVTPDGIKPNPIKVKAIVSYPIPTKDKEIRAFLGLTGYYRKFIPNYADIAKPMTSCLKKRTKIDTQKLEYIEAFEKLKALIIRDPILQLPDFEKKFVLTTDASNLALGAVLSQNGHPISFISRTLNDHELNYSAIEKELLAIVWATKTFRHYLLGRQFLIASDHQPLRWLHNLKEPGAKLERWRVRLSEYQFKIDYIKGKENSVADALSRI 623          

HSP 2 Score: 26.1794 bits (56), Expect = 8.283e-37
Identity = 10/33 (30.30%), Postives = 22/33 (66.67%), Query Frame = 1
Query:   34 LVFFNDILVYSKTWADHIFHLKTVLQILSDNSL 132
            LV+ +DI+++S +  +H+  ++ V   L+D +L
Sbjct:  361 LVYLDDIIIFSTSLTEHLNSIQLVFTKLADANL 393          
BLAST of CK935224 vs. ExPASy Swiss-Prot
Match: RTF21_SCHPO (Retrotransposable element Tf2 155 kDa protein type 1 OS=Schizosaccharomyces pombe GN=Tf2-1 PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 1.456e-32
Identity = 84/236 (35.59%), Postives = 125/236 (52.97%), Query Frame = 3
Query:  141 KSKCCFGVLQVEYLGHLISLVGVAVDPKKIQTVLEWPIPSSTKEVRGFLRLASYYRKFIRGFGGIATPLTRLLTKE-GFHWTSEAESAFTQLKHALTSPHVLRLQDFSQPFVVECDACGVGIGAISSQ---NDK--PVAFFSEALQGSMLVLPTCEKEMLAIVKAIRKWRPYLLG--KPFIVRTDQKSL--KFLMEQRITTMAQT*WLPKILGYDYTIQCKKRSENRGADALSRLV 818
            ++KC F   QV+++G+ IS  G     + I  VL+W  P + KE+R FL   +Y RKFI     +  PL  LL K+  + WT     A   +K  L SP VLR  DFS+  ++E DA  V +GA+ SQ   +DK  PV ++S  +  + L     +KEMLAI+K+++ WR YL    +PF + TD ++L  +   E          W   +  +++ I  +  S N  ADALSR+V
Sbjct:  598 QAKCEFHQSQVKFIGYHISEKGFTPCQENIDKVLQWKQPKNRKELRQFLGSVNYLRKFIPKTSQLTHPLNNLLKKDVRWKWTPTQTQAIENIKQCLVSPPVLRHFDFSKKILLETDASDVAVGAVLSQKHDDDKYYPVGYYSAKMSKAQLNYSVSDKEMLAIIKSLKHWRHYLESTIEPFKILTDHRNLIGRITNESEPENKRLARWQLFLQDFNFEINYRPGSANHIADALSRIV 833          

HSP 2 Score: 33.4982 bits (75), Expect = 1.456e-32
Identity = 14/36 (38.89%), Postives = 26/36 (72.22%), Query Frame = 1
Query:   25 SQFLVFFNDILVYSKTWADHIFHLKTVLQILSDNSL 132
            S  + + +DIL++SK+ ++H+ H+K VLQ L + +L
Sbjct:  559 SHVVCYMDDILIHSKSESEHVKHVKDVLQKLKNANL 594          
BLAST of CK935224 vs. ExPASy Swiss-Prot
Match: RTF23_SCHPO (Retrotransposable element Tf2 155 kDa protein type 3 OS=Schizosaccharomyces pombe GN=Tf2-11 PE=4 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 5.454e-32
Identity = 84/236 (35.59%), Postives = 125/236 (52.97%), Query Frame = 3
Query:  141 KSKCCFGVLQVEYLGHLISLVGVAVDPKKIQTVLEWPIPSSTKEVRGFLRLASYYRKFIRGFGGIATPLTRLLTKE-GFHWTSEAESAFTQLKHALTSPHVLRLQDFSQPFVVECDACGVGIGAISSQ---NDK--PVAFFSEALQGSMLVLPTCEKEMLAIVKAIRKWRPYLLG--KPFIVRTDQKSL--KFLMEQRITTMAQT*WLPKILGYDYTIQCKKRSENRGADALSRLV 818
            ++KC F   QV+++G+ IS  G     + I  VL+W  P + KE+R FL   +Y RKFI     +  PL  LL K+  + WT     A   +K  L SP VLR  DFS+  ++E DA  V +GA+ SQ   +DK  PV ++S  +  + L     +KEMLAI+K+++ WR YL    +PF + TD ++L  +   E          W   +  +++ I  +  S N  ADALSR+V
Sbjct:  598 QAKCEFHQSQVKFIGYHISEKGFTPCQENIDKVLQWKQPKNRKELRQFLGSVNYLRKFIPKTSQLTHPLNNLLKKDVRWKWTPTQTQAIENIKQCLVSPPVLRHFDFSKKILLETDASDVAVGAVLSQKHDDDKYYPVGYYSAKMSKAQLNYSVSDKEMLAIIKSLKHWRHYLESTIEPFKILTDHRNLIGRITNESEPENKRLARWQLFLQDFNFEINYRPGSANHIADALSRIV 833          

HSP 2 Score: 31.5722 bits (70), Expect = 5.454e-32
Identity = 13/36 (36.11%), Postives = 26/36 (72.22%), Query Frame = 1
Query:   25 SQFLVFFNDILVYSKTWADHIFHLKTVLQILSDNSL 132
            S  + + ++IL++SK+ ++H+ H+K VLQ L + +L
Sbjct:  559 SHVVCYMDNILIHSKSESEHVKHVKDVLQKLKNANL 594          
BLAST of CK935224 vs. ExPASy Swiss-Prot
Match: RTF22_SCHPO (Retrotransposable element Tf2 155 kDa protein type 2 OS=Schizosaccharomyces pombe GN=Tf2-7 PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 5.454e-32
Identity = 84/236 (35.59%), Postives = 125/236 (52.97%), Query Frame = 3
Query:  141 KSKCCFGVLQVEYLGHLISLVGVAVDPKKIQTVLEWPIPSSTKEVRGFLRLASYYRKFIRGFGGIATPLTRLLTKE-GFHWTSEAESAFTQLKHALTSPHVLRLQDFSQPFVVECDACGVGIGAISSQ---NDK--PVAFFSEALQGSMLVLPTCEKEMLAIVKAIRKWRPYLLG--KPFIVRTDQKSL--KFLMEQRITTMAQT*WLPKILGYDYTIQCKKRSENRGADALSRLV 818
            ++KC F   QV+++G+ IS  G     + I  VL+W  P + KE+R FL   +Y RKFI     +  PL  LL K+  + WT     A   +K  L SP VLR  DFS+  ++E DA  V +GA+ SQ   +DK  PV ++S  +  + L     +KEMLAI+K+++ WR YL    +PF + TD ++L  +   E          W   +  +++ I  +  S N  ADALSR+V
Sbjct:  598 QAKCEFHQSQVKFIGYHISEKGFTPCQENIDKVLQWKQPKNRKELRQFLGSVNYLRKFIPKTSQLTHPLNNLLKKDVRWKWTPTQTQAIENIKQCLVSPPVLRHFDFSKKILLETDASDVAVGAVLSQKHDDDKYYPVGYYSAKMSKAQLNYSVSDKEMLAIIKSLKHWRHYLESTIEPFKILTDHRNLIGRITNESEPENKRLARWQLFLQDFNFEINYRPGSANHIADALSRIV 833          

HSP 2 Score: 31.5722 bits (70), Expect = 5.454e-32
Identity = 13/36 (36.11%), Postives = 26/36 (72.22%), Query Frame = 1
Query:   25 SQFLVFFNDILVYSKTWADHIFHLKTVLQILSDNSL 132
            S  + + ++IL++SK+ ++H+ H+K VLQ L + +L
Sbjct:  559 SHVVCYMDNILIHSKSESEHVKHVKDVLQKLKNANL 594          
BLAST of CK935224 vs. ExPASy Swiss-Prot
Match: POL4_DROME (Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster GN=POL PE=4 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 6.896e-32
Identity = 82/236 (34.75%), Postives = 121/236 (51.27%), Query Frame = 3
Query:  147 KCCFGVLQVEYLGHLISLVGVAVDPKKIQTVLEWPIPSSTKEVRGFLRLASYYRKFIRGFGGIATPLTRLLTKE-GFHWTSEAESAFTQLKHALTSPHVLRLQDFSQPFVVECDACGVGIGAISSQNDK----PVAFFSEALQGSMLVLPTCEKEMLAIVKAIRKWRPYLLGKPFIVRTDQKSLKFLMEQRITTMAQT*WLPKILGYDYTIQCKKRSENRGADALSRLVXLEFSAI 839
            KC F + +V +LGH  +  G+  D KK   +  +P+P      R F+   +YYR+FI+ F   +  +TRL  K   F WT E + AF  LK  L +P +L+  DFS+ F +  DA     GA+ +QN      PVA+ S A         T E+E+ AI  AI  +RPY+ GK F V+TD + L +L      +   T    ++  Y++T++  K  +N  ADALSR+   E   I
Sbjct:  508 KCSFFMHEVTFLGHKCTDKGILPDDKKYDVIQNYPVPHDADSARRFVAFCNYYRRFIKNFADYSRHITRLCKKNVPFEWTDECQKAFIHLKSQLINPTLLQYPDFSKEFCITTDASKQACGAVLTQNHNGHQLPVAYASRAFTKGESNKSTTEQELAAIHWAIIHFRPYIYGKHFTVKTDHRPLTYLFSMVNPSSKLTRIRLELEEYNFTVEYLKGKDNHVADALSRITIKELKDI 743          
BLAST of CK935224 vs. ExPASy Swiss-Prot
Match: POLY_DROME (Retrovirus-related Pol polyprotein from transposon gypsy OS=Drosophila melanogaster GN=pol PE=4 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 5.889e-31
Identity = 83/228 (36.40%), Postives = 117/228 (51.32%), Query Frame = 3
Query:  171 VEYLGHLISLVGVAVDPKKIQTVLEWPIPSSTKEVRGFLRLASYYRKFIRGFGGIATPLTRLLTKEG------------FHWTSEAESAFTQLKHALTSPHV-LRLQDFSQPFVVECDACGVGIGAISSQNDKPVAFFSEALQGSMLVLPTCEKEMLAIVKAIRKWRPYLLGKPFI-VRTDQKSLKFLMEQRITTMAQT*WLPKILGYDYTIQCKKRSENRGADALSR 812
            VEYLG ++S  G   DP+K++ + E+P P    +VR FL LASYYR FI+ F  IA P+T +L  E               +     +AF +L++ L S  V L+  DF +PF +  DA   GIGA+ SQ  +P+   S  L+       T E+E+LAIV A+ K + +L G   I + TD + L F +  R T      W   I  ++  +  K   EN  ADALSR
Sbjct:  383 VEYLGFIVSKDGTKSDPEKVKAIQEYPEPDCVYKVRSFLGLASYYRVFIKDFAAIARPITDILKGENGSVSKHMSKKIPVEFNETQRNAFQRLRNILASEDVILKYPDFKKPFDLTTDASASGIGAVLSQEGRPITMISRTLKQPEQNYATNERELLAIVWALGKLQNFLYGSREINIFTDHQPLTFAVADRNTNAKIKRWKSYIDQHNAKVFYKPGKENFVADALSR 610          

HSP 2 Score: 32.3426 bits (72), Expect = 5.889e-31
Identity = 11/32 (34.38%), Postives = 24/32 (75.00%), Query Frame = 1
Query:   37 VFFNDILVYSKTWADHIFHLKTVLQILSDNSL 132
            V+ +D++++S+  +DH+ H+ TVL+ L D ++
Sbjct:  338 VYVDDVIIFSENESDHVRHIDTVLKCLIDANM 369          
BLAST of CK935224 vs. ExPASy Swiss-Prot
Match: POL5_DROME (Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster GN=pol PE=4 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 7.137e-29
Identity = 83/233 (35.62%), Postives = 121/233 (51.93%), Query Frame = 3
Query:  168 QVEYLGHLISLVGVAVDPKKIQTVLEWPIPSSTKEVRGFLRLASYYRKFIRGFGGIATPLTRLL------------TKEGFHWTSEAESAFTQLKHALTSPHVLRLQDFSQPFVVECDACGVGIGAISSQN----DKPVAFFSEALQGSMLVLPTCEKEMLAIVKAIRKWRPYLLGKPFI-VRTDQKSLKFLMEQRITTMAQT*WLPKILGYDYTIQCKKRSENRGADALSRL 815
            QVE+LG++++  G+  DPKK++ + E P P+S KE++ FL + SYYRKFI+ +  +A PLT L             +K        A  +F  LK  L S  +L    F++PF +  DA    IGA+ SQ+    D+P+A+ S +L  +     T EKEMLAI+ ++   R YL G   I V TD + L F +  R        W  +I  Y+  +  K    N  ADALSR+
Sbjct:  323 QVEFLGYIVTADGIKADPKKVRAISEMPPPTSVKELKRFLGMTSYYRKFIQDYAKVAKPLTNLTRGLYANIKSSQSSKVPITLDETALQSFNDLKSILCSSEILAFPCFTKPFHLTTDASNWAIGAVLSQDDQGRDRPIAYISRSLNKTEENYATIEKEMLAIIWSLDNLRAYLYGAGTIKVYTDHQPLTFALGNRNFNAKLKRWKARIEEYNCELIYKPGKSNVVADALSRI 555          
BLAST of CK935224 vs. ExPASy Swiss-Prot
Match: YG31B_YEAST (Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY3B-G PE=1 SV=3)

HSP 1 Score: 115.546 bits (288), Expect = 2.533e-28
Identity = 75/233 (32.19%), Postives = 118/233 (50.64%), Query Frame = 3
Query:  138 KKSKCCFGVLQVEYLGHLISLVGVAVDPKKIQTVLEWPIPSSTKEVRGFLRLASYYRKFIRGFGGIATPLTRLLTKEGFHWTSEAESAFTQLKHALTSPHVLRLQDFSQPFVVECDACGVGIGAISSQNDKP------VAFFSEALQGSMLVLPTCEKEMLAIVKAIRKWRPYLLGKPFIVRTDQKSLKFLMEQRITTMAQT*WLPKILGYDYTIQCKKRSENRGADALSRLV 818
            KK KC F   + E+LG+ I +  +A    K   + ++P P + K+ + FL + +YYR+FI     IA P+ +L   +   WT + + A  +LK AL +  VL   +    + +  DA   GIGA+  + D        V +FS++L+ +    P  E E+L I+KA+  +R  L GK F +RTD  SL  L  +         WL  +  YD+T++     +N  ADA+SR V
Sbjct:  779 KKKKCKFASEETEFLGYSIGIQKIAPLQHKCAAIRDFPTPKTVKQAQRFLGMINYYRRFIPNCSKIAQPI-QLFICDKSQWTEKQDKAIDKLKDALCNSPVLVPFNNKANYRLTTDASKDGIGAVLEEVDNKNKLVGVVGYFSKSLESAQKNYPAGELELLGIIKALHHFRYMLHGKHFTLRTDHISLLSLQNKNEPARRVQRWLDDLATYDFTLEYLAGPKNVVADAISRAV 1010          

HSP 2 Score: 31.5722 bits (70), Expect = 2.533e-28
Identity = 14/37 (37.84%), Postives = 25/37 (67.57%), Query Frame = 1
Query:   37 VFFNDILVYSKTWADHIFHLKTVLQILSDNSLFKKNQ 147
            V+ +DIL++S++  +H  HL TVL+ L + +L  K +
Sbjct:  745 VYLDDILIFSESPEEHWKHLDTVLERLKNENLIVKKK 781          
BLAST of CK935224 vs. ExPASy Swiss-Prot
Match: YI31B_YEAST (Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae GN=TY3B-I PE=3 SV=2)

HSP 1 Score: 114.775 bits (286), Expect = 4.294e-28
Identity = 74/233 (31.76%), Postives = 118/233 (50.64%), Query Frame = 3
Query:  138 KKSKCCFGVLQVEYLGHLISLVGVAVDPKKIQTVLEWPIPSSTKEVRGFLRLASYYRKFIRGFGGIATPLTRLLTKEGFHWTSEAESAFTQLKHALTSPHVLRLQDFSQPFVVECDACGVGIGAISSQNDKP------VAFFSEALQGSMLVLPTCEKEMLAIVKAIRKWRPYLLGKPFIVRTDQKSLKFLMEQRITTMAQT*WLPKILGYDYTIQCKKRSENRGADALSRLV 818
            KK KC F   + E+LG+ I +  +A    K   + ++P P + K+ + FL + +YYR+FI     IA P+ +L   +   WT + + A  +LK AL +  VL   +    + +  DA   GIGA+  + D        V +FS++L+ +    P  E E+L I+KA+  +R  L GK F +RTD  SL  L  +         WL  +  YD+T++     +N  ADA+SR +
Sbjct:  805 KKKKCKFASEETEFLGYSIGIQKIAPLQHKCAAIRDFPTPKTVKQAQRFLGMINYYRRFIPNCSKIAQPI-QLFICDKSQWTEKQDKAIEKLKAALCNSPVLVPFNNKANYRLTTDASKDGIGAVLEEVDNKNKLVGVVGYFSKSLESAQKNYPAGELELLGIIKALHHFRYMLHGKHFTLRTDHISLLSLQNKNEPARRVQRWLDDLATYDFTLEYLAGPKNVVADAISRAI 1036          

HSP 2 Score: 31.5722 bits (70), Expect = 4.294e-28
Identity = 14/37 (37.84%), Postives = 25/37 (67.57%), Query Frame = 1
Query:   37 VFFNDILVYSKTWADHIFHLKTVLQILSDNSLFKKNQ 147
            V+ +DIL++S++  +H  HL TVL+ L + +L  K +
Sbjct:  771 VYLDDILIFSESPEEHWKHLDTVLERLKNENLIVKKK 807          
The following BLAST results are available for this feature:
BLAST of CK935224 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
POL3_DROME1.695e-3737.33Retrovirus-related Pol polyprotein from transposon... [more]
POL2_DROME8.283e-3736.89Retrovirus-related Pol polyprotein from transposon... [more]
RTF21_SCHPO1.456e-3235.59Retrotransposable element Tf2 155 kDa protein type... [more]
RTF23_SCHPO5.454e-3235.59Retrotransposable element Tf2 155 kDa protein type... [more]
RTF22_SCHPO5.454e-3235.59Retrotransposable element Tf2 155 kDa protein type... [more]
POL4_DROME6.896e-3234.75Retrovirus-related Pol polyprotein from transposon... [more]
POLY_DROME5.889e-3136.40Retrovirus-related Pol polyprotein from transposon... [more]
POL5_DROME7.137e-2935.62Retrovirus-related Pol polyprotein from transposon... [more]
YG31B_YEAST2.533e-2832.19Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomy... [more]
YI31B_YEAST4.294e-2831.76Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomy... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit 24 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004564_C08 Developing fruit 24 DAFB Citrus sinensis cDNA clone T24DAB0001_IIIF_C08 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK935224 ID=CK935224|Name=CK935224|organism=Citrus sinensis|type=EST|length=840bp
GGGGATAAATTAAATGATTGATTGTCTCAATTCTTAGTTTTTTTTAATGA
TATTTTGGTGTACAGCAAAACTTGGGCAGATCATATTTTCCATCTTAAAA
CAGTTTTGCAGATTTTATCTGATAACTCTCTGTTTAAAAAAAATCAAAGT
GTTGTTTTGGAGTTTTGCAGGTAGAGTATTTGGGTCATCTTATTTCCCTT
GTAGGAGTGGCTGTTGATCCAAAGAAAATTCAAACCGTACTTGAGTGGCC
AATTCCATCATCGACTAAAGAAGTAAGGGGCTTTCTTAGATTAGCGAGTT
ATTACCGCAAGTTCATTCGAGGCTTTGGGGGAATTGCAACACCTTTAACT
AGGCTATTAACAAAGGAAGGCTTTCATTGGACCTCAGAAGCAGAATCTGC
CTTCACTCAGTTGAAGCACGCATTAACATCTCCTCATGTTCTTCGATTGC
AGGACTTTTCACAGCCATTTGTTGTCGAGTGTGATGCTTGTGGAGTCGGT
ATTGGAGCTATATCATCACAAAATGACAAGCCAGTAGCATTTTTTAGTGA
GGCACTCCAGGGTTCTATGTTGGTCTTGCCCACATGCGAGAAAGAGATGC
TTGCAATCGTCAAGGCAATTCGCAAATGGCGTCCCTATTTGTTGGGTAAG
CCTTTCATTGTTCGTACAGACCAAAAGAGCCTAAAATTTTTAATGGAACA
ACGCATTACAACCATGGCTCAGACATGATGGTTGCCAAAAATTCTTGGCT
ATGATTATACAATTCAATGCAAAAAAAGATCAGAAAATCGAGGTGCCGAC
GCTTTATCACGATTAGTANAGCTTGAATTTTCAGCAATCT
back to top