CK935413

Overview
NameCK935413
Unique NameCK935413
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length926
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3182 contig Csv1_Contig3182:340..1265. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK935413 vs. ExPASy Swiss-Prot
Match: SRG1_ARATH (Protein SRG1 OS=Arabidopsis thaliana GN=SRG1 PE=2 SV=1)

HSP 1 Score: 378.637 bits (971), Expect = 2.681e-104
Identity = 185/296 (62.50%), Postives = 225/296 (76.01%), Query Frame = 3
Query:   48 VEQKMAKIGGSLLVPCVQELVKNPMLV-VPPRYICPDEDSPLNSDDTLIS-QIPVIDMQXXXXXXXXXXXXAKLDFACKEWGFFQLVNHGVSSAFLEKVKKEVKGFFNLSMEEKKKYWQHPGDVEGFGQAFVVSEEQKLDWADIFSMITLPVHLRKPHLFPKLPPSLRDTLEVYSMELKSLAMNLISKMGKVLNIKDEELREFFD--NGFQSMRMNYYPPCPQPEKVMGLTPHSDGSALTILLQINEVEGLQIKNNGKWIPITPLPNAFIVNIGDTLEIMTNGTYRSIEHRAIVNS 923
            +E K A    S+LVP VQE+VK   +  VPPRY+  D+D     DD  +  +IP+IDM+             KLDFACKEWGFFQLVNHG+ S+FL+KVK E++ FFNL MEEKKK+WQ P ++EGFGQAFVVSE+QKLDWAD+F     PV LRKPHLFPKLP   RDTLE+YS E++S+A  LI+KM + L IK EEL + FD  +  QSMRMNYYPPCPQP++V+GLTPHSD   LT+L+Q+N+VEGLQIK +GKW+P+ PLPNAFIVNIGD LEI+TNGTYRSIEHR +VNS
Sbjct:    1 MEAKGAAQWSSILVPSVQEMVKEKTITTVPPRYVRSDQDKTEVDDDFDVKIEIPIIDMKRLCSSTTMDSEVEKLDFACKEWGFFQLVNHGIDSSFLDKVKSEIQDFFNLPMEEKKKFWQRPDEIEGFGQAFVVSEDQKLDWADLFFHTVQPVELRKPHLFPKLPLPFRDTLEMYSSEVQSVAKILIAKMARALEIKPEELEKLFDDVDSVQSMRMNYYPPCPQPDQVIGLTPHSDSVGLTVLMQVNDVEGLQIKKDGKWVPVKPLPNAFIVNIGDVLEIITNGTYRSIEHRGVVNS 296          
BLAST of CK935413 vs. ExPASy Swiss-Prot
Match: NCS1_COPJA (S-norcoclaurine synthase 1 OS=Coptis japonica GN=NCS1 PE=1 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 7.890e-64
Identity = 130/294 (44.22%), Postives = 180/294 (61.22%), Query Frame = 3
Query:   48 VEQKMAKIGGSLLVPCVQELVKNPMLVVPPRYICPD--EDSPLNSDDTLISQIPVIDMQXXXXXXXXXXXXAKLDFACKEWGFFQLVNHGVSSAFLEKVKKEVKGFFNLSMEEKKKYWQHPGDVEGFGQAFVVSEEQKLDWADIFSMITLPVHLRKPHLFPKLPPSLRDTLEVYSMELKSLAMNLISKMGKVLNIKDEELREFFDNGFQSMRMNYYPPCPQPEKVMGLTPHSDGSALTILLQINEVEGLQIKNNGKWIPITPLPNAFIVNIGDTLEIMTNGTYRSIEHRAIVNS 923
            + + +  +GGSL V  VQ L    +  +P RY+ P+   D  +  D++L  +IPVID+             AK   AC +WGFFQL+NHGV    +EK+K + + FF L  +EK  Y Q P  +EG+GQAFV SEEQKLDWAD+  +IT PV  R    +P  P S R+T+E YSMEL+ +AM L   M K L ++ E L +     F +      P      + +GL+PHSD + LT+L+Q+NEV GL IK + KW+PI P+  AF+VNIGD +EIM+NG Y+SIEHRA++N+
Sbjct:    1 MSKNLTGVGGSLPVENVQVLAGKELKNLPNRYVRPELEHDDVVPIDNSL--EIPVIDLSRLLDQQYACDELAKFHSACLDWGFFQLINHGVREEVIEKMKVDTEDFFRLPFKEKNAYRQLPNGMEGYGQAFVTSEEQKLDWADMHFLITKPVQERNMRFWPTSPTSFRETMEKYSMELQKVAMCLTGMMAKNLGLESEILTKPLRTVF-NREDELLPSMSSCGEGLGLSPHSDATGLTLLIQVNEVNGLHIKKDEKWVPIKPILGAFVVNIGDVIEIMSNGIYKSIEHRAVINT 291          
BLAST of CK935413 vs. ExPASy Swiss-Prot
Match: LDOX_ARATH (Leucoanthocyanidin dioxygenase OS=Arabidopsis thaliana GN=LDOX PE=1 SV=1)

HSP 1 Score: 169.474 bits (428), Expect = 2.470e-41
Identity = 97/288 (33.68%), Postives = 155/288 (53.82%), Query Frame = 3
Query:   96 VQELVKNPMLVVPPRYICPDEDSPLNSDDTLIS------QIPVIDMQXXXXXXXXXXXXA--KLDFACKEWGFFQLVNHGVSSAFLEKVKKEVKGFFNLSMEEKKKYW--QHPGDVEGFGQAFVVSEEQKLDWADIFSMITLPVHLRKPHLFPKLPPSLRDTLEVYSMELKSLAMNLISKMGKVLNIKDEELREF---FDNGFQSMRMNYYPPCPQPEKVMGLTPHSDGSALTILLQINEVEGLQIKNNGKWIPITPLPNAFIVNIGDTLEIMTNGTYRSIEHRAIVN 920
            V+ L K+ ++ +P  YI P E+    +D  L        Q+P ID++               +L  A  +WG   L+NHG+ +  +E+VKK  + FF+LS+EEK+KY   Q  G ++G+G     +   +L+W D F  +  P   R   ++PK P    +    Y+  L+ LA  +   +   L ++ + L +     +     M++NYYP CPQPE  +G+  H+D SALT +L  N V GLQ+   GKW+    +P++ +++IGDTLEI++NG Y+SI HR +VN
Sbjct:    7 VESLAKSGIISIPKEYIRPKEELESINDVFLEEKKEDGPQVPTIDLKNIESDDEKIRENCIEELKKASLDWGVMHLINHGIPADLMERVKKAGEEFFSLSVEEKEKYANDQATGKIQGYGSKLANNASGQLEWEDYFFHLAYPEEKRDLSIWPKTPSDYIEATSEYAKCLRLLATKVFKALSVGLGLEPDRLEKEVGGLEELLLQMKINYYPKCPQPELALGVEAHTDVSALTFILH-NMVPGLQLFYEGKWVTAKCVPDSIVMHIGDTLEILSNGKYKSILHRGLVN 293          
BLAST of CK935413 vs. ExPASy Swiss-Prot
Match: LDOX_VITVI (Leucoanthocyanidin dioxygenase OS=Vitis vinifera PE=2 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 5.502e-41
Identity = 103/299 (34.45%), Postives = 156/299 (52.17%), Query Frame = 3
Query:   84 LVPCVQELVKNPMLVVPPRYICPDEDSPLNSDDTLIS--------QIPVIDMQXXXXXXXXXXXXAK------LDFACKEWGFFQLVNHGVSSAFLEKVKKEVKGFFNLSMEEKKKYW--QHPGDVEGFGQAFVVSEEQKLDWADIFSMITLPVHLRKPHLFPKLPPSLRDTLEVYSMELKSLAMNLISKMGKVLNIKDEELREFFDNGFQSM----RMNYYPPCPQPEKVMGLTPHSDGSALTILLQINEVEGLQIKNNGKWIPITPLPNAFIVNIGDTLEIMTNGTYRSIEHRAIVN 920
            + P V+ L  + +  +P  YI P E+  L S   +          Q+P ID++             +      L  A  EWG   LVNHG+S   + +VK   + FFNL MEEK+KY   Q  G + G+G     +   +L+W D F  +  P   R   ++PK P         YS++L+SLA  ++S +   L +++  L +    G + +    ++NYYP CPQPE  +G+  H+D SALT +L  N V GLQ+   GKW+    +PN+ I++IGDT+EI++NG Y+SI HR +VN
Sbjct:    5 VAPRVESLSSSGIQSIPKEYIRPQEE--LTSIGNVFEEEKKDEGPQVPTIDLKDIESEDEVVRREIRERCREELKKAAMEWGVMHLVNHGISDDLINRVKVAGETFFNLPMEEKEKYANDQASGKIAGYGSKLANNASGQLEWEDYFFHLIFPEDKRDMTIWPKTPSDYVPATCEYSVKLRSLATKILSVLSLGLGLEEGRLEKEV-GGMEELLLQKKINYYPKCPQPELALGVEAHTDVSALTFILH-NMVPGLQLFYEGKWVTAKCVPNSIIMHIGDTIEILSNGKYKSILHRGLVN 299          
BLAST of CK935413 vs. ExPASy Swiss-Prot
Match: LDOX_MALDO (Leucoanthocyanidin dioxygenase OS=Malus domestica GN=ANS PE=2 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 1.601e-40
Identity = 97/289 (33.56%), Postives = 152/289 (52.60%), Query Frame = 3
Query:   96 VQELVKNPMLVVPPRYICPDEDSPLNSDDTLIS-------QIPVIDMQXXXXXXXXXXXXA--KLDFACKEWGFFQLVNHGVSSAFLEKVKKEVKGFFNLSMEEKKKYW--QHPGDVEGFGQAFVVSEEQKLDWADIFSMITLPVHLRKPHLFPKLPPSLRDTLEVYSMELKSLAMNLISKMGKVLNIKDEELREF---FDNGFQSMRMNYYPPCPQPEKVMGLTPHSDGSALTILLQINEVEGLQIKNNGKWIPITPLPNAFIVNIGDTLEIMTNGTYRSIEHRAIVN 920
            V+ L  + +  +P  YI P +D  +N  D           Q+P ID++               KL  A  +WG   LVNHG+S   ++KV+K  K FF+L +E+K+KY   Q  G ++G+G     +   +L+W D F     P   R   ++P+ P    +    Y+ +L+ LA  ++  +   L + +  L +     +     M++NYYP CPQPE  +G+  H+D SALT +L  N V GLQ+   GKW+    +PN+ +++IGDTLEI++NG Y+SI HR +VN
Sbjct:   11 VETLAGSGISTIPKEYIRP-KDELVNIGDIFEQEKNNEGPQVPTIDLKEIESDNEKVRAKCREKLKKAAVDWGVMHLVNHGISDELMDKVRKAGKAFFDLPIEQKEKYANDQASGKIQGYGSKLANNASGQLEWEDYFFHCVYPEDKRDLSIWPQTPADYIEATAEYAKQLRELATKVLKVLSLGLGLDEGRLEKEVGGLEELLLQMKINYYPKCPQPELALGVEAHTDVSALTFILH-NMVPGLQLFYEGKWVTAKCVPNSIVMHIGDTLEILSNGKYKSILHRGMVN 297          
BLAST of CK935413 vs. ExPASy Swiss-Prot
Match: LDOX_PETHY (Leucoanthocyanidin dioxygenase OS=Petunia hybrida GN=ANT17 PE=2 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 3.567e-40
Identity = 96/289 (33.22%), Postives = 154/289 (53.29%), Query Frame = 3
Query:   96 VQELVKNPMLVVPPRYICPDEDSPLNSDDTLIS--------QIPVIDMQXXXXXXXXXXXXA-KLDFACKEWGFFQLVNHGVSSAFLEKVKKEVKGFFNLSMEEKKKYW--QHPGDVEGFGQAFVVSEEQKLDWADIFSMITLPVHLRKPHLFPKLPPSLRDTLEVYSMELKSLAMNLISKMGKVLNIKDEELREF---FDNGFQSMRMNYYPPCPQPEKVMGLTPHSDGSALTILLQINEVEGLQIKNNGKWIPITPLPNAFIVNIGDTLEIMTNGTYRSIEHRAIVN 920
            V+ L K+ +  +P  Y+ P E+  LN    +          Q+P ID++              +L  A  EWG   LVNHG+S   + +VK   + FF+  +EEK+KY   Q  G+V+G+G     S   +L+W D F     P   R   ++PK P         Y+ ++++LA  +++ +   L +++  L +     ++    M++NYYP CPQPE  +G+  H+D SALT +L  N V GLQ+   G+W+    +PN+ I++IGDT+EI++NG Y+SI HR +VN
Sbjct:   12 VESLAKSGIQAIPKEYVRPQEE--LNGIGNIFEEEKKDEGPQVPTIDLKEIDSEDKEIREKCHQLKKAAMEWGVMHLVNHGISDELINRVKVAGETFFDQPVEEKEKYANDQANGNVQGYGSKLANSACGQLEWEDYFFHCAFPEDKRDLSIWPKNPTDYTPATSEYAKQIRALATKILTVLSIGLGLEEGRLEKEVGGMEDLLLQMKINYYPKCPQPELALGVEAHTDVSALTFILH-NMVPGLQLFYEGQWVTAKCVPNSIIMHIGDTIEILSNGKYKSILHRGVVN 297          
BLAST of CK935413 vs. ExPASy Swiss-Prot
Match: LDOX_PERFR (Leucoanthocyanidin dioxygenase OS=Perilla frutescens GN=ANS PE=2 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 1.038e-39
Identity = 95/291 (32.65%), Postives = 150/291 (51.55%), Query Frame = 3
Query:   90 PCVQELVKNPMLVVPPRYICPDEDSPLNSDDTLIS-------QIPVIDMQXXXXXXXXXXXXA--KLDFACKEWGFFQLVNHGVSSAFLEKVKKEVKGFFNLSMEEKKKYW--QHPGDVEGFGQAFVVSEEQKLDWADIFSMITLPVHLRKPHLFPKLPPSLRDTLEVYSMELKSLAMNLISKMGKVLNIKDEELREFFDNG---FQSMRMNYYPPCPQPEKVMGLTPHSDGSALTILLQINEVEGLQIKNNGKWIPITPLPNAFIVNIGDTLEIMTNGTYRSIEHRAIVN 920
            P V+EL ++ +  +P  Y+ P+E+      + L         Q+P ID++               +L  A  +WG   L+NHG+    +++VK   K FF L +EEK+ Y   Q  G+V+G+G     +   +L+W D F     P H     ++P  PP        Y+ +L++LA  ++S +   L ++   L +           M++N+YP CPQPE  +G   H+D SALT +L  N V GLQ+    KW+    +PN+ I++IGDTLEI++NG Y+SI HR +VN
Sbjct:   10 PRVEELARSGLDTIPKDYVRPEEELKSIIGNILAEEKSSEGPQLPTIDLEEMDSRDEEGRKKCHEELKKAATDWGVMHLINHGIPEELIDRVKAAGKEFFELPVEEKEAYANDQAAGNVQGYGSKLANNASGQLEWEDYFFHCVYPEHKTDLSIWPTKPPDYIPATSEYAKQLRALATKILSVLSIGLGLEKGRLEKEVGGAEDLIVQMKINFYPKCPQPELALGWEAHTDVSALTFILH-NMVPGLQLFYEDKWVTAKCVPNSIIMHIGDTLEILSNGKYKSILHRGLVN 299          
BLAST of CK935413 vs. ExPASy Swiss-Prot
Match: GAO1D_WHEAT (Gibberellin 20 oxidase 1-D OS=Triticum aestivum GN=GA20ox1D PE=1 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 2.556e-38
Identity = 93/272 (34.19%), Postives = 143/272 (52.57%), Query Frame = 3
Query:  129 VPPRYICPDEDSPLNSDDTLISQIPVIDMQXXXXXXXXXXXXAK--LDFACKEWGFFQLVNHGVSSAFLEKVKKEVKGFFNLSMEEKKKYWQHPGDVEGFGQAFVVSEEQKLDWADIFSMITLPVH--LRKPHLFPKLPPSLRDTLEVYSM---ELKSLAMNLISKMGKVLNIKDEELREFFDNGFQSMRMNYYPPCPQPEKVMGLTPHSDGSALTILLQINEVEGLQIKNNGKWIPITPLPNAFIVNIGDTLEIMTNGTYRSIEHRAIVNS 923
            +P ++I P+ +SP   D      +P+ID+                 +  AC+  GFFQ+VNHG+ +  L    + V  FF + + EK++  +HPG+  G+  +F      KL W +  S  + P    L   ++   L    R   EVY+    E+  L++ ++  +G+ L +     R FF+     MR+NYYPPC +P + +G  PH D ++LTIL Q N V GLQ+   G+W  I P  +AF+VNIGDT   ++NG Y+S  HRA+VNS
Sbjct:   17 IPSQFIWPEGESP-TPDAAEELHVPLIDIGGMLSGDPAAAAEVTRLVGEACERHGFFQVVNHGIDAELLADAHRCVDNFFTMPLPEKQRALRHPGESCGYASSFTGRFASKLPWKETLSFRSCPSDPALVVDYIVATLGEDHRRLGEVYARYCSEMSRLSLEIMEVLGESLGVGRAHYRRFFEGNDSIMRLNYYPPCQRPLETLGTGPHCDPTSLTILHQDN-VGGLQVHTEGRWRSIRPRADAFVVNIGDTFMALSNGRYKSCLHRAVVNS 286          
BLAST of CK935413 vs. ExPASy Swiss-Prot
Match: FLS_PETHY (Flavonol synthase/flavanone 3-hydroxylase OS=Petunia hybrida GN=FL PE=2 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 4.360e-38
Identity = 92/273 (33.70%), Postives = 145/273 (53.11%), Query Frame = 3
Query:  120 MLVVPPRYICPDEDSPLNSD-DTLISQIPVIDMQXXXXXXXXXXXXAKLDFACKEWGFFQLVNHGVSSAFLEKVKKEVKGFF-NLSMEEKKKYWQHPG--DVEGFGQAFVVSEEQKLDWADIFSMITLPVHLRKPHLFPKLPPSLRDTLEVYSMELKSLAMNLISKMGKVLNIKDEELREFF--DNGFQSMRMNYYPPCPQPEKVMGLTPHSDGSALTILLQINEVEGLQIKNNGKWIPITPLPNAFIVNIGDTLEIMTNGTYRSIEHRAIVN 920
            M  +P  YI  + + P  +    ++ Q+PVID++              +  A KEWG FQL+NHG+    +  ++K  K FF ++  EEK+   + PG  D+EG+G +     E K  W D       P        +PK PPS R+  E Y   ++ +   +   +   L ++  E+ E    D     +++NYYPPCP+P+  +G+  H+D S +TIL+  NEV+GLQ+  +G W  +  +PNA IV+IGD +EI++NG Y+S+ HR  VN
Sbjct:   28 MDTIPSEYIRSENEQPAATTLHGVVLQVPVIDLRDPDENKMVKL----IADASKEWGIFQLINHGIPDEAIADLQKVGKEFFEHVPQEEKELIAKTPGSNDIEGYGTSLQKEVEGKKGWVDHLFHKIWPPSAVNYRYWPKNPPSYREANEEYGKRMREVVDRIFKSLSLGLGLEGHEMIEAAGGDEIVYLLKINYYPPCPRPDLALGVVAHTDMSYITILVP-NEVQGLQVFKDGHWYDVKYIPNALIVHIGDQVEILSNGKYKSVYHRTTVN 295          
BLAST of CK935413 vs. ExPASy Swiss-Prot
Match: FLS_PETCR (Flavonol synthase/flavanone 3-hydroxylase OS=Petroselinum crispum GN=FLS PE=1 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 7.437e-38
Identity = 90/272 (33.09%), Postives = 145/272 (53.31%), Query Frame = 3
Query:  120 MLVVPPRYICPDEDSP-LNSDDTLISQIPVIDMQXXXXXXXXXXXXAKLDFACKEWGFFQLVNHGVSSAFLEKVKKEVKGFFNLSMEEKKKYWQHPG--DVEGFGQAFVVSEEQKLDWADIFSMITLPVHLRKPHLFPKLPPSLRDTLEVYSMELKSLAMNLISKMGKVLNIKDEELREFF--DNGFQSMRMNYYPPCPQPEKVMGLTPHSDGSALTILLQINEVEGLQIKNNGKWIPITPLPNAFIVNIGDTLEIMTNGTYRSIEHRAIVN 920
            M  +P  YI  + + P + +   ++ Q+PVID+               +  A +EWG FQ+VNHG+    + K++K  K FF L  +EK+   +  G   VEG+G         K  W D    I  P      + +P  PP  R+  E Y++ L+ +   L   +   + ++  EL++    D+    +++NYYPPCP+P+  +G+  H+D SA+TIL+  NEV+GLQ+  +  W  +  +PNA I++IGD +EIM+NG Y+S+ HR  VN
Sbjct:   16 MDTIPSEYIRSESEQPAVTTMQGVVLQVPVIDLGSSNNTEENLVEL--IAEASREWGIFQVVNHGIPDDAIAKLQKVGKEFFELPQQEKEVIAKPEGYQGVEGYGTKLQKELGGKKGWVDHLFHIIWPKSAVNYNFWPNNPPLYREANEEYAVALRGVVDKLFEALSLGIGLEKHELKKASGGDDLIYMLKINYYPPCPRPDLALGVVAHTDMSAITILVP-NEVQGLQVHKDDHWYDVKYIPNALIIHIGDQIEIMSNGKYKSVYHRTTVN 284          
The following BLAST results are available for this feature:
BLAST of CK935413 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 86
Match NameE-valueIdentityDescription
SRG1_ARATH2.681e-10462.50Protein SRG1 OS=Arabidopsis thaliana GN=SRG1 PE=2 ... [more]
NCS1_COPJA7.890e-6444.22S-norcoclaurine synthase 1 OS=Coptis japonica GN=N... [more]
LDOX_ARATH2.470e-4133.68Leucoanthocyanidin dioxygenase OS=Arabidopsis thal... [more]
LDOX_VITVI5.502e-4134.45Leucoanthocyanidin dioxygenase OS=Vitis vinifera P... [more]
LDOX_MALDO1.601e-4033.56Leucoanthocyanidin dioxygenase OS=Malus domestica ... [more]
LDOX_PETHY3.567e-4033.22Leucoanthocyanidin dioxygenase OS=Petunia hybrida ... [more]
LDOX_PERFR1.038e-3932.65Leucoanthocyanidin dioxygenase OS=Perilla frutesce... [more]
GAO1D_WHEAT2.556e-3834.19Gibberellin 20 oxidase 1-D OS=Triticum aestivum GN... [more]
FLS_PETHY4.360e-3833.70Flavonol synthase/flavanone 3-hydroxylase OS=Petun... [more]
FLS_PETCR7.437e-3833.09Flavonol synthase/flavanone 3-hydroxylase OS=Petro... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit 24 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004555_H07 Developing fruit 24 DAFB Citrus sinensis cDNA clone T24DAB0004_IVF_H07 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK935413 ID=CK935413|Name=CK935413|organism=Citrus sinensis|type=EST|length=926bp
GGGGGTTCCAAAACCAATACAAAACTGTAGCAATCTTAAGAGGATTTGTG
GAACAAAAGATGGCCAAGATTGGAGGTTCTCTGCTTGTTCCTTGTGTTCA
AGAGTTGGTCAAGAATCCTATGTTAGTTGTCCCTCCTAGATACATTTGTC
CGGACGAAGATTCACCACTCAATTCTGATGATACTTTGATTTCACAGATA
CCAGTTATTGACATGCAGAGCTTGCTTTCTGAAGAATCAATGGATTCTGA
GTTAGCCAAGCTCGACTTCGCTTGCAAAGAATGGGGTTTTTTCCAGCTGG
TAAACCATGGAGTAAGCTCAGCATTTCTAGAGAAAGTGAAGAAAGAGGTT
AAGGGCTTCTTCAATCTCAGCATGGAAGAAAAGAAAAAATATTGGCAGCA
TCCAGGAGATGTAGAAGGATTTGGACAAGCCTTTGTTGTATCTGAGGAAC
AAAAGCTTGATTGGGCTGACATTTTCTCCATGATCACTCTTCCAGTTCAT
CTGAGGAAGCCACACTTATTTCCTAAGCTCCCTCCTTCCCTCAGAGACAC
CTTGGAAGTTTACTCGATGGAGTTAAAATCTCTGGCCATGAACCTGATAT
CGAAAATGGGAAAAGTTTTAAATATCAAAGATGAAGAATTGAGAGAATTC
TTTGACAATGGTTTCCAATCAATGAGGATGAACTATTACCCTCCATGTCC
TCAGCCAGAAAAGGTTATGGGCCTCACCCCTCATTCTGATGGCTCTGCTC
TTACCATTCTGCTACAAATCAATGAAGTAGAAGGTCTCCAGATCAAGAAC
AATGGAAAATGGATTCCTATCACACCGCTGCCAAATGCTTTCATTGTCAA
CATCGGAGACACATTGGAGATTATGACCAATGGGACATACCGTAGCATTG
AACATCGTGCAATTGTGAACTCTATG
back to top