CK935507

Overview
NameCK935507
Unique NameCK935507
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length918
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1824 contig Csv1_Contig1824:1..918. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK935507 vs. ExPASy Swiss-Prot
Match: NAC8_ARATH (NAC domain-containing protein 8 OS=Arabidopsis thaliana GN=NAC008 PE=2 SV=1)

HSP 1 Score: 401.364 bits (1030), Expect = 3.821e-111
Identity = 191/262 (72.90%), Postives = 214/262 (81.68%), Query Frame = 1
Query:   85 MAGPSWLVDSNRIATKIKSASGLGDPERVKWKSNPTKACPNCHHVIDNSDVAHEWPGLPRGVKFDPSDQEIIWHLLAKAGLEGLNPHPFIDEFIPTVDQDGGICYTHPQNLPGVKQDGSAAHFFYRAIKAYSTGTRKRRKINGDDFGEVRWHKTGRTKPVMLDGVQKGCKKIMVLYMSMVRGGKAEKTNWVMHQYHLGTEEDEKDRDYVISKISYQQQQ---AKYGDKIEQDILEST-GAIIPKVDPVTPKLVTPDPPRTER 858
            MAG SWL+DSNRIATKI SAS   DP +V WKSNP++ CP C HVIDNSDV  +WPGLPRGVKFDPSD EIIWHLLAK+GL GL+ HPFIDEFIPTV+QD GICYTHP+NLPGVK DG+ +HFF++AIKAYSTGTRKRRKI+ DDFG+VRWHKTGRTKPV+LDGVQ+GCKKIMVLY     GGKA KTNWVMHQYHLG EEDEK+ DYV+SKI YQQ Q    K GDK EQ++ E    A+ P  DPVTPKL TP+P    R
Sbjct:    1 MAGRSWLIDSNRIATKIMSASASSDPRQVVWKSNPSRHCPKCQHVIDNSDVVDDWPGLPRGVKFDPSDPEIIWHLLAKSGLSGLSSHPFIDEFIPTVNQDDGICYTHPKNLPGVKSDGTVSHFFHKAIKAYSTGTRKRRKIHDDDFGDVRWHKTGRTKPVVLDGVQRGCKKIMVLY-----GGKAVKTNWVMHQYHLGIEEDEKEGDYVVSKIFYQQPQQLVVKRGDKAEQEVSEDIFAAVTPTADPVTPKLATPEPRNAVR 257          
BLAST of CK935507 vs. ExPASy Swiss-Prot
Match: NAC4_ARATH (NAC domain-containing protein 4 OS=Arabidopsis thaliana GN=NAC004 PE=2 SV=2)

HSP 1 Score: 76.6406 bits (187), Expect = 2.156e-13
Identity = 54/190 (28.42%), Postives = 88/190 (46.32%), Query Frame = 1
Query:  259 PRGVKFDPSDQEIIWHLLAKAGLEGLNPHPFIDEFIPTVDQDGGICYTHPQNLPG---VKQDGSAAHFFYRAIKAYSTGTRKRRKINGDDFGEVRWHKTGRTKPVMLDGVQK---GCKKIMVLYMSMVRGGKAEKTNWVMHQYHLGTEEDEKDRDYVISKISYQQQQAKYGDKIEQDILESTGAIIPKVD 810
            P G +F P+D+EI+ H L    L+    H  +DE I TVD    IC   P +LP    +K      +FF      Y+ G ++RR+ N        W KTG+T  VM     +   G K+++V      +     KT+WVMH+YH  +    +   Y + K+ ++ ++ +         +E   ++IP V+
Sbjct:    4 PVGFRFRPNDEEIVDHYLRPKNLDSDTSH--VDEVISTVD----ICSFEPWDLPSKSMIKSRDGVWYFFSVKEMKYNRGDQQRRRTNSGF-----WKKTGKTMTVMRKRGNREKIGEKRVLVF-----KNRDGSKTDWVMHEYHATSLFPNQMMTYTVCKVEFKGEETEISSSSTGSEIEQIHSLIPLVN 177          
The following BLAST results are available for this feature:
BLAST of CK935507 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
NAC8_ARATH3.821e-11172.90NAC domain-containing protein 8 OS=Arabidopsis tha... [more]
NAC4_ARATH2.156e-1328.42NAC domain-containing protein 4 OS=Arabidopsis tha... [more]
back to top
Libraries
Library NameType
Developing fruit 24 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004554_H01 Developing fruit 24 DAFB Citrus sinensis cDNA clone T24DAB0004_IIIF_H01 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK935507 ID=CK935507|Name=CK935507|organism=Citrus sinensis|type=EST|length=918bp
GGGGATTACGGAATATTTCATTTTCGTTTCAATTAAGAATACACCAAAAA
TTAAAGCCAAAGAAGCGAAGCAGAGCAAAAAGTGATGGCTGGACCGTCAT
GGTTGGTGGACAGTAACAGAATTGCTACAAAGATCAAGAGTGCATCTGGC
TTAGGTGATCCGGAAAGAGTTAAATGGAAGAGCAATCCTACGAAAGCTTG
TCCCAATTGCCACCATGTCATCGATAACAGTGATGTTGCTCACGAGTGGC
CAGGATTACCCAGGGGTGTGAAATTTGACCCATCTGATCAAGAAATTATA
TGGCATTTACTTGCAAAAGCTGGTTTGGAAGGCTTGAATCCCCATCCATT
TATTGATGAGTTCATCCCTACTGTTGATCAAGATGGTGGAATCTGTTACA
CCCATCCTCAGAATTTGCCAGGTGTTAAGCAAGATGGAAGTGCAGCACAC
TTCTTTTATAGAGCTATCAAGGCTTACAGTACTGGAACTCGAAAGCGTAG
AAAGATAAATGGTGATGATTTTGGTGAGGTGCGCTGGCACAAGACTGGCA
GGACTAAACCAGTGATGTTAGATGGGGTTCAAAAAGGGTGTAAGAAGATT
ATGGTTCTCTATATGAGCATGGTCAGAGGAGGGAAAGCTGAGAAAACTAA
TTGGGTGATGCACCAGTATCACTTGGGAACAGAGGAGGATGAAAAGGATA
GGGACTATGTTATATCTAAAATATCTTATCAGCAGCAACAGGCCAAGTAT
GGTGATAAAATTGAACAAGATATTCTTGAAAGCACTGGTGCCATCATTCC
AAAAGTAGATCCAGTCACTCCCAAGTTAGTGACTCCAGACCCACCTCGTA
CTGAAAGGCATCCTGATTTTGGCCCACGGCAAGAGTCTCCTACTACAGAT
GCATTTGATCAGCAATCT
back to top