CK935512

Overview
NameCK935512
Unique NameCK935512
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length861
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10176 contig Csv1_Contig10176:1..857. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK935512 vs. ExPASy Swiss-Prot
Match: MIRA_RICDU (Miraculin OS=Richadella dulcifica PE=1 SV=3)

HSP 1 Score: 105.145 bits (261), Expect = 5.113e-22
Identity = 69/191 (36.13%), Postives = 101/191 (52.88%), Query Frame = 3
Query:   96 PLLGISSNS-EPVLDIIGNKVKSTLEYKLIPVLDGAGGFSTHLGT--NGQ--CPLDVIQLSSPSERGDNLRLLPYDNYK--IVKVSTDVNLRFPVKVSVKPCN--EEPLWKVDSYDDP----LIVTGGSEGHPGAETLLNWFKIEKAGNFSYGGVYNIVHCPSVCLSCPRRCNKIGVSTKDGVRRLLLVGD 629
            PLL  + ++  PVLDI G K+++   Y ++PVL   GG  T   T  NG   CP  V+Q     +    L   P +N K  +V+VSTD+N+ F    +  PC      +W++D YD+      +  GG +G+PG ET+ +WFKIE+   F   G Y +V CP+VC SC  +C  +G+      RR L + D
Sbjct:   24 PLLSAADSAPNPVLDIDGEKLRTGTNYYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFP-ENPKEDVVRVSTDLNINFS---AFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEE---FCGSGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSD 207          
BLAST of CK935512 vs. ExPASy Swiss-Prot
Match: ASP_THECC (21 kDa seed protein OS=Theobroma cacao GN=ASP PE=2 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 5.113e-22
Identity = 64/179 (35.75%), Postives = 98/179 (54.75%), Query Frame = 3
Query:  120 SEPVLDIIGNKVKSTLEYKLIPVLDGAGGFSTHLG--TNGQCPLDVIQLSSPSERGDNLRLLPYDNYK-IVKVSTDVNLRFPVKVSVKPCNEEPLWKVDSYDDPL----IVTGGSEGHPGAETLLNWFKIEKAGNFSYGGVYNIVHCPSVCLSCPRRCNKIGVSTKDGVRRLLLVGDHE 635
            + PVLD  G+++++ ++Y ++  + GAGG    LG  T   CP  V+Q  S  + G  +     D+   +V+VSTDVN+ F V +  + C+   +W++D+YD+      + T G +G PG  TL +WFKIEKAG       Y    CPSVC SC   C+ IG  + D  +  L + D+E
Sbjct:   28 NSPVLDTDGDELQTGVQYYVLSSISGAGGGGLALGRATGQSCPEIVVQRRSDLDNGTPVIFSNADSKDDVVRVSTDVNIEF-VPIRDRLCSTSTVWRLDNYDNSAGKWWVTTDGVKGEPGPNTLCSWFKIEKAGVLG----YKFRFCPSVCDSCTTLCSDIGRHSDDDGQIRLALSDNE 201          
BLAST of CK935512 vs. ExPASy Swiss-Prot
Match: LSPI_CARPA (Latex serine proteinase inhibitor OS=Carica papaya PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 1.142e-13
Identity = 58/179 (32.40%), Postives = 91/179 (50.84%), Query Frame = 3
Query:  123 EPVLDIIGNKVKSTLEYKLIPVLDGAGGFSTHL---GTNGQCPLDVIQLSSPSERGDNLRLLPYDNYK--IVKVSTDVNLRFPVKVSVKPCNEEPLWKVDSYDDPL---IVTGGSEGHPGAETLLNWFKIEKAG-NFSYGGVYNIVHCPSVCLSCPRRCNKIGV-STKDGVRRLLLVGD 629
            +P++DI G  V   ++Y ++  + GAGG    +   G   +CPL V+Q   P + G+ +      N K  IV  S D+N++F + ++   CNE   WKVD +   +   +  GG +G+ G E+  + FKI+KAG  FS    Y    CPS   +    CN + +   K  +RRL+L  D
Sbjct:    4 KPIVDIDGKPVLYGVDYFVVSAIWGAGGGGLTVYGPGNKKKCPLSVVQ--DPFDNGEPIIFSAIKNVKDNIVFESVDLNVKFNITIN---CNETTAWKVDRFPGVIGWTVTLGGEKGYHGFESTHSMFKIKKAGLPFS----YKFHFCPSYPRTRLIPCNNVDIFFDKYRIRRLILTND 173          
BLAST of CK935512 vs. ExPASy Swiss-Prot
Match: SPI2_SOLTU (Serine protease inhibitor 2 OS=Solanum tuberosum PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.491e-13
Identity = 59/194 (30.41%), Postives = 100/194 (51.55%), Query Frame = 3
Query:  108 ISSNSEPVLDIIGNKVKSTLEYKLIPVLDGAGGFSTHLG----TNGQCPLDVIQLSSP-SERGDNLRLLPYDNY--KIVKVSTDVNLRFPVKVSVKPCNEEPLWKVDSYDDPL----IVTGGSEGHPGAETLLNWFKIEKAGNFSYGGVYNIVHCPSVCLSCPRRCNKIGVSTKDGVRRLLLVGDHEPALNVLF 656
            + S++ PVLD+ G ++ S L Y++I    GA G   +LG    ++  C   + + +S     G  +R +   ++  + +  +  +N++F +  S K C    +WKV  YD  L    + TGG+ G   +    +WFKI K+    Y    N+++CP    S  + C+K+GV  ++G RRL LV  +E  L+VLF
Sbjct:    1 LPSDATPVLDVTGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAISTS-KLCVSYTIWKVGDYDASLGTMLLETGGTIGQADS----SWFKIVKSSQLGY----NLLYCPVTSSSDDQFCSKVGVVHQNGKRRLALV--NENPLDVLF 183          
BLAST of CK935512 vs. ExPASy Swiss-Prot
Match: SPI7_SOLTU (Serine protease inhibitor 7 OS=Solanum tuberosum PE=1 SV=2)

HSP 1 Score: 75.8702 bits (185), Expect = 3.322e-13
Identity = 58/194 (29.90%), Postives = 100/194 (51.55%), Query Frame = 3
Query:  102 LGISSNSEPVLDIIGNKVKSTLEYKLIPVLDGAGGFSTHLG----TNGQCPLDVIQLSSP-SERGDNLRLLPYDNY--KIVKVSTDVNLRFPVKVSVKPCNEEPLWKVDSYD----DPLIVTGGSEGHPGAETLLNWFKIEKAGNFSYGGVYNIVHCP-SVCLSCP-----RRCNKIGVSTKDGVRRLLLVGDH 632
            + + S++ PVLD+ G ++ S L Y++I    GA G   +LG    ++  C   + + +S     G  +R +   ++  + +  +  +N++F +  S K C    +WKV  YD      L+ TGG+ G   +    +WFKI K+  F     YN+++CP +  +SCP     + C K+GV  ++G RRL LV D+
Sbjct:   27 INLPSDATPVLDVAGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAISTS-KLCVSYTIWKVGDYDASLGTMLLETGGTIGQADS----SWFKIVKSSQFG----YNLLYCPVTSTMSCPFSSDDQFCLKVGVVHQNGKRRLALVKDN 211          
BLAST of CK935512 vs. ExPASy Swiss-Prot
Match: SPI1_SOLTU (Serine protease inhibitor 1 OS=Solanum tuberosum PE=1 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 1.262e-12
Identity = 58/194 (29.90%), Postives = 99/194 (51.03%), Query Frame = 3
Query:  102 LGISSNSEPVLDIIGNKVKSTLEYKLIPVLDGAGGFSTHLG----TNGQCPLDVIQLSSP-SERGDNLRLLPYDNY--KIVKVSTDVNLRFPVKVSVKPCNEEPLWKVDSYD----DPLIVTGGSEGHPGAETLLNWFKIEKAGNFSYGGVYNIVHCP-SVCLSCP-----RRCNKIGVSTKDGVRRLLLVGDH 632
            + + S++ PVLD+ G ++ S L Y++I    GA G   +LG    ++  C   V + +S     G  +R +   ++  + +  +  +N++F +  S K C    +WKV  YD      L+ TGG+ G   +    +WFKI K+        YN+++CP +  +SCP     + C K+GV  ++G RRL LV D+
Sbjct:   27 INLPSDATPVLDVTGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGVFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAISTS-KLCVSYTIWKVGDYDASLGTMLLETGGTIGQADS----SWFKIVKSSQLG----YNLLYCPVTSTMSCPFSSDDQFCLKVGVVHQNGKRRLALVKDN 211          
BLAST of CK935512 vs. ExPASy Swiss-Prot
Match: DRTI_DELRE (Kunitz-type serine protease inhibitor DrTI OS=Delonix regia PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 3.673e-12
Identity = 59/192 (30.73%), Postives = 88/192 (45.83%), Query Frame = 3
Query:  114 SNSEPVLDIIGNKVKSTLEYKLIPVLDGAGGFSTHLG-TNGQ-CPLDVIQLSSPSERGDNLRLL-PYDNYKIVKVSTDVNLRFPVKVSVKPCNEEPLWK-VDSYDDPLIVTGGSEGHPGAETLLNWFKIEKAGNFSYGGVYNIVHCPSVCLSCPRRCNKIGVSTKDGVRRLLLVGDHEPALNVLFFPSEESS 677
            S++E V DI G  V    EY ++  + GAGG     G T G  CP+ +IQ  S  + G  +R   P ++   +   T++ + F   V    C E   W  V    +  +  GGSE HP  E +  +FKIEK G+ +    Y +V CP    S    C+ IG++  +G R L+L    +    V+F      S
Sbjct:    1 SDAEKVYDIEGYPVFLGSEYYIVSAIIGAGGGGVRPGRTRGSMCPMSIIQEQSDLQMGLPVRFSSPEESQGKIYTDTELEIEF---VEKPDCAESSKWVIVKDSGEARVAIGGSEDHPQGELVRGFFKIEKLGSLA----YKLVFCPK---SSSGSCSDIGIN-YEGRRSLVLKSSDDSPFRVVFVKPRSGS 181          
BLAST of CK935512 vs. ExPASy Swiss-Prot
Match: SPI6_SOLTU (Probable serine protease inhibitor 6 OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 8.182e-12
Identity = 56/194 (28.87%), Postives = 98/194 (50.52%), Query Frame = 3
Query:  102 LGISSNSEPVLDIIGNKVKSTLEYKLIPVLDGAGGFSTHLG----TNGQCPLDVIQLSSP-SERGDNLRLLPYDNY--KIVKVSTDVNLRFPVKVSVKPCNEEPLWKVDSYD----DPLIVTGGSEGHPGAETLLNWFKIEKAGNFSYGGVYNIVHCP-SVCLSCP-----RRCNKIGVSTKDGVRRLLLVGDH 632
            + + S++ PVLD+ G ++   L Y +I    GA G   +LG    ++  C   + + +S     G  +R +   ++  + +  +  +N++F +  S K C    +WKV  YD      L+ TGG+ G   +    +WFKI ++  F     YN+++CP +  +SCP     + C K+GV  ++G RRL LV D+
Sbjct:   27 INLPSDATPVLDVTGKELDPRLSYHIISTFWGALGGDVYLGKSPNSDAPCANGIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAISTS-KLCVSYTIWKVGDYDASLGTMLLETGGTIGQADS----SWFKIVQSSQFG----YNLLYCPVTSTMSCPFSSDDQFCLKVGVVHQNGKRRLALVKDN 211          
BLAST of CK935512 vs. ExPASy Swiss-Prot
Match: API9_SOLTU (Aspartic protease inhibitor 9 OS=Solanum tuberosum PE=1 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 8.182e-12
Identity = 60/192 (31.25%), Postives = 92/192 (47.92%), Query Frame = 3
Query:  123 EPVLDIIGNKVKSTLEYKLIPVLDGAGGFSTHLG----TNGQCPLDVIQLSSP-SERGDNLRLLPYDNYKIVKVSTDVNLRFPVKVSVKPCNEEPLWKVDS----YDDPLIVTGGSEGHPGAETLLNWFKIEKAGNFSYGGVYNIVHCP---SVCLSCP--RRCNKIGVSTKDGVRRLLLVGDHEPALNVLF 656
            +PVLD  G ++     Y++I +  GA G   +LG    ++  CP  V + +S     G  +R +P           ++    P   +VK C    +WKV +    +   L+ TGG+ G        ++FKI K  NF     YN++ CP    +CL CP  + C K+GV  ++G RRL LV  +E  L+VLF
Sbjct:    6 KPVLDTNGKELNPNSSYRIISIGAGALGGDVYLGKSPNSDAPCPDGVFRYNSDVGPSGTPVRFIPLSGGIFEDQLLNIQFNIP---TVKLCVSYTIWKVGNLNAYFRTMLLETGGTIGQADN----SYFKIVKLSNFG----YNLLSCPFTSIICLRCPEDQFCAKVGVVIQNGKRRLALV--NENPLDVLF 184          
BLAST of CK935512 vs. ExPASy Swiss-Prot
Match: API2_SOLTU (Aspartic protease inhibitor 2 OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.069e-11
Identity = 63/202 (31.19%), Postives = 100/202 (49.50%), Query Frame = 3
Query:   93 QPLLGISSNS---EPVLDIIGNKVKSTLEYKLIPVLDGAGGFSTHLG----TNGQCPLDVIQLSSP-SERGDNLRLLPYDNYKIVKVSTDVNLRFPVKVSVKPCNEEPLWKVDS----YDDPLIVTGGSEGHPGAETLLNWFKIEKAGNFSYGGVYNIVHCPSVCLSC--PRRCNKIGVSTKDGVRRLLLVGDHEPALNVLF 656
            Q L+ + S S   +PVLD  G ++     Y++I +  GA G   +LG    ++G CP  V + +S     G  +R +P      +     +N++F +  +VK C    +WKV +    +   L+ TGG+ G   +    ++FKI K  NF Y  +Y  +  P +C  C     C K+GV  ++G RRL LV  +E  L+VLF
Sbjct:   25 QNLIDLPSESPLPKPVLDTNGKELNPNSSYRIISIGRGALGGDVYLGKSPNSDGPCPDGVFRYNSDVGPSGTFVRFIPLSGG--IFEDQLLNIQFNI-ATVKLCVSYTIWKVGNLNAYFRTMLLETGGTIGQADS----SYFKIVKLSNFGYNLLYCPITPPFLCPFCRDDNFCAKVGVVIQNGKRRLALV--NENPLDVLF 217          
The following BLAST results are available for this feature:
BLAST of CK935512 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
MIRA_RICDU5.113e-2236.13Miraculin OS=Richadella dulcifica PE=1 SV=3[more]
ASP_THECC5.113e-2235.7521 kDa seed protein OS=Theobroma cacao GN=ASP PE=2... [more]
LSPI_CARPA1.142e-1332.40Latex serine proteinase inhibitor OS=Carica papaya... [more]
SPI2_SOLTU1.491e-1330.41Serine protease inhibitor 2 OS=Solanum tuberosum P... [more]
SPI7_SOLTU3.322e-1329.90Serine protease inhibitor 7 OS=Solanum tuberosum P... [more]
SPI1_SOLTU1.262e-1229.90Serine protease inhibitor 1 OS=Solanum tuberosum P... [more]
DRTI_DELRE3.673e-1230.73Kunitz-type serine protease inhibitor DrTI OS=Delo... [more]
SPI6_SOLTU8.182e-1228.87Probable serine protease inhibitor 6 OS=Solanum tu... [more]
API9_SOLTU8.182e-1231.25Aspartic protease inhibitor 9 OS=Solanum tuberosum... [more]
API2_SOLTU1.069e-1131.19Aspartic protease inhibitor 2 OS=Solanum tuberosum... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit 24 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004554_H06 Developing fruit 24 DAFB Citrus sinensis cDNA clone T24DAB0004_IIIF_H06 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK935512 ID=CK935512|Name=CK935512|organism=Citrus sinensis|type=EST|length=861bp
GGGGAACAAACAGCAGCCAGCCTTCCAGTGGCAAAAAAATGAAGACTTCA
TTGATAACAACACTCTCCTTCCTTATCCTTACCTTGGCCACGCAGCCTCT
ATTGGGCATCTCATCAAACTCTGAACCTGTCTTAGATATCATTGGCAACA
AGGTCAAATCCACCCTCGAGTATAAACTTATCCCAGTCCTAGATGGCGCC
GGTGGATTCAGCACACACCTAGGCACAAATGGACAGTGTCCCTTGGACGT
TATCCAATTAAGTTCTCCTAGCGAAAGGGGAGATAATTTAAGATTACTTC
CGTACGACAATTACAAAATTGTCAAGGTATCCACTGATGTCAACCTGAGA
TTCCCCGTAAAAGTTTCTGTTAAGCCCTGTAATGAAGAACCATTGTGGAA
AGTTGATAGCTATGACGATCCATTAATTGTAACCGGCGGAAGTGAGGGCC
ACCCAGGAGCTGAAACGTTGCTAAATTGGTTTAAGATTGAGAAAGCTGGA
AATTTTTCATATGGTGGTGTATACAATATTGTCCATTGTCCGAGTGTCTG
TCTATCTTGTCCTAGACGCTGCAACAAAATTGGCGTTTCAACTAAGGATG
GCGTTCGACGTCTGCTTCTAGTTGGTGATCATGAACCGGCTTTGAATGTT
CTGTTTTTTCCATCAGAGGAAAGCTCAAGGCTACTTCAAGCTGCTAACGC
AATATCAAGGTTTTTTGAAGCTGCTGAAGCAATATCAATGACCGCGTAAT
GAATGAACTTAGCTGTATCATTCTAAATAATAGACCAGGCTAGTAACCTT
TTATCTCTATTACAGAATAAAAATAACACCGCCTGTGATCCTTTTGCTGT
TGTCAAAAAAA
back to top