CK935520

Overview
NameCK935520
Unique NameCK935520
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length795
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CK935520 vs. ExPASy Swiss-Prot
Match: ARF_DUGJA (ADP-ribosylation factor OS=Dugesia japonica PE=2 SV=3)

HSP 1 Score: 201.06 bits (510), Expect = 6.027e-51
Identity = 87/140 (62.14%), Postives = 115/140 (82.14%), Query Frame = 3
Query:    9 IGEVLSTVPTIGFNVEKVQYKNVIFTVWDVGGQEKLRPLWRHYFNNTDGLIYVVDSLDRERIGKAKQEFQAIIKDPFMLNSVILVFANKQDMKGAMTPMEVCEGLGLFDLKNRKWHIQGTCALKGDGLYEGLDWLASTLK 428
            +GE+++T+PTIGFNVE V+YKN+ FTVWDVGGQ+K+RPLWRHYF NT GLI+VVDS DRER+ +A++E   ++ +  + ++V+LVFANKQD+  AM P E+ + LGL  L+NR W+IQ TCA  GDGLYEGLDWL++TLK
Sbjct:   39 LGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSTTLK 178          
BLAST of CK935520 vs. ExPASy Swiss-Prot
Match: ARF1_LOCMI (ADP-ribosylation factor 1 OS=Locusta migratoria GN=ARF1 PE=2 SV=2)

HSP 1 Score: 197.593 bits (501), Expect = 6.663e-50
Identity = 86/140 (61.43%), Postives = 114/140 (81.43%), Query Frame = 3
Query:    9 IGEVLSTVPTIGFNVEKVQYKNVIFTVWDVGGQEKLRPLWRHYFNNTDGLIYVVDSLDRERIGKAKQEFQAIIKDPFMLNSVILVFANKQDMKGAMTPMEVCEGLGLFDLKNRKWHIQGTCALKGDGLYEGLDWLASTLK 428
            +GE+++T+PTIGFNVE V+YKN+ FTVWDVGGQ+K+RPLWRHYF NT GLI+VVDS DRERIG+A++E   ++ +  + ++V+L+FANKQD+  AM   E+ + LGL  L+NR W+IQ TCA  GDGLYEGLDWL++ LK
Sbjct:   39 LGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSLRNRNWYIQATCATSGDGLYEGLDWLSNQLK 178          
BLAST of CK935520 vs. ExPASy Swiss-Prot
Match: ARF1_DROME (ADP-ribosylation factor 1 OS=Drosophila melanogaster GN=Arf79F PE=1 SV=2)

HSP 1 Score: 197.593 bits (501), Expect = 6.663e-50
Identity = 86/140 (61.43%), Postives = 114/140 (81.43%), Query Frame = 3
Query:    9 IGEVLSTVPTIGFNVEKVQYKNVIFTVWDVGGQEKLRPLWRHYFNNTDGLIYVVDSLDRERIGKAKQEFQAIIKDPFMLNSVILVFANKQDMKGAMTPMEVCEGLGLFDLKNRKWHIQGTCALKGDGLYEGLDWLASTLK 428
            +GE+++T+PTIGFNVE V+YKN+ FTVWDVGGQ+K+RPLWRHYF NT GLI+VVDS DRERIG+A++E   ++ +  + ++V+L+FANKQD+  AM   E+ + LGL  L+NR W+IQ TCA  GDGLYEGLDWL++ LK
Sbjct:   39 LGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERIGEAREELMRMLAEDELRDAVLLIFANKQDLPNAMNAAEITDKLGLHSLRNRNWYIQATCATSGDGLYEGLDWLSNQLK 178          
BLAST of CK935520 vs. ExPASy Swiss-Prot
Match: ARF12_CAEEL (ADP-ribosylation factor 1-like 2 OS=Caenorhabditis elegans GN=arf-1.2 PE=1 SV=2)

HSP 1 Score: 197.208 bits (500), Expect = 8.702e-50
Identity = 87/140 (62.14%), Postives = 114/140 (81.43%), Query Frame = 3
Query:    9 IGEVLSTVPTIGFNVEKVQYKNVIFTVWDVGGQEKLRPLWRHYFNNTDGLIYVVDSLDRERIGKAKQEFQAIIKDPFMLNSVILVFANKQDMKGAMTPMEVCEGLGLFDLKNRKWHIQGTCALKGDGLYEGLDWLASTLK 428
            +GE+++T+PTIGFNVE V+YKN+ FTVWDVGGQ+K+RPLWRHYF NT GLI+VVDS DRER+G+A++E   ++ +  + ++V+LVFANKQD+  AM   EV + LGL  L+NR W+IQ TCA  GDGLYEGLDWL++ LK
Sbjct:   39 LGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELMRMLAEDELRDAVLLVFANKQDLPQAMNAAEVTDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSNQLK 178          
BLAST of CK935520 vs. ExPASy Swiss-Prot
Match: ARF12_CAEBR (ADP-ribosylation factor 1-like 2 OS=Caenorhabditis briggsae GN=arf-1.2 PE=3 SV=3)

HSP 1 Score: 197.208 bits (500), Expect = 8.702e-50
Identity = 87/140 (62.14%), Postives = 114/140 (81.43%), Query Frame = 3
Query:    9 IGEVLSTVPTIGFNVEKVQYKNVIFTVWDVGGQEKLRPLWRHYFNNTDGLIYVVDSLDRERIGKAKQEFQAIIKDPFMLNSVILVFANKQDMKGAMTPMEVCEGLGLFDLKNRKWHIQGTCALKGDGLYEGLDWLASTLK 428
            +GE+++T+PTIGFNVE V+YKN+ FTVWDVGGQ+K+RPLWRHYF NT GLI+VVDS DRER+G+A++E   ++ +  + ++V+LVFANKQD+  AM   EV + LGL  L+NR W+IQ TCA  GDGLYEGLDWL++ LK
Sbjct:   39 LGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREELMRMLAEDELRDAVLLVFANKQDLPQAMNAAEVTDKLGLHSLRNRSWYIQATCATSGDGLYEGLDWLSNQLK 178          
BLAST of CK935520 vs. ExPASy Swiss-Prot
Match: ARF3_TAKRU (ADP-ribosylation factor 3 OS=Takifugu rubripes GN=arf3 PE=3 SV=2)

HSP 1 Score: 194.897 bits (494), Expect = 4.319e-49
Identity = 85/143 (59.44%), Postives = 114/143 (79.72%), Query Frame = 3
Query:    9 IGEVLSTVPTIGFNVEKVQYKNVIFTVWDVGGQEKLRPLWRHYFNNTDGLIYVVDSLDRERIGKAKQEFQAIIKDPFMLNSVILVFANKQDMKGAMTPMEVCEGLGLFDLKNRKWHIQGTCALKGDGLYEGLDWLASTLKEMR 437
            +GE+++T+PTIGFNVE V+YKN+ FTVWDVGGQ+K+RPLWRHYF NT GLI+VVDS DRER+ +A++E   ++ +  + ++V+LVFANKQD+  AM   E+ + LGL  L++R W+IQ TCA  GDGLYEGLDWLA+ LK  +
Sbjct:   39 LGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK 181          
BLAST of CK935520 vs. ExPASy Swiss-Prot
Match: ARF3_RAT (ADP-ribosylation factor 3 OS=Rattus norvegicus GN=Arf3 PE=2 SV=2)

HSP 1 Score: 194.897 bits (494), Expect = 4.319e-49
Identity = 85/143 (59.44%), Postives = 114/143 (79.72%), Query Frame = 3
Query:    9 IGEVLSTVPTIGFNVEKVQYKNVIFTVWDVGGQEKLRPLWRHYFNNTDGLIYVVDSLDRERIGKAKQEFQAIIKDPFMLNSVILVFANKQDMKGAMTPMEVCEGLGLFDLKNRKWHIQGTCALKGDGLYEGLDWLASTLKEMR 437
            +GE+++T+PTIGFNVE V+YKN+ FTVWDVGGQ+K+RPLWRHYF NT GLI+VVDS DRER+ +A++E   ++ +  + ++V+LVFANKQD+  AM   E+ + LGL  L++R W+IQ TCA  GDGLYEGLDWLA+ LK  +
Sbjct:   39 LGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK 181          
BLAST of CK935520 vs. ExPASy Swiss-Prot
Match: ARF3_PONAB (ADP-ribosylation factor 3 OS=Pongo abelii GN=ARF3 PE=2 SV=3)

HSP 1 Score: 194.897 bits (494), Expect = 4.319e-49
Identity = 85/143 (59.44%), Postives = 114/143 (79.72%), Query Frame = 3
Query:    9 IGEVLSTVPTIGFNVEKVQYKNVIFTVWDVGGQEKLRPLWRHYFNNTDGLIYVVDSLDRERIGKAKQEFQAIIKDPFMLNSVILVFANKQDMKGAMTPMEVCEGLGLFDLKNRKWHIQGTCALKGDGLYEGLDWLASTLKEMR 437
            +GE+++T+PTIGFNVE V+YKN+ FTVWDVGGQ+K+RPLWRHYF NT GLI+VVDS DRER+ +A++E   ++ +  + ++V+LVFANKQD+  AM   E+ + LGL  L++R W+IQ TCA  GDGLYEGLDWLA+ LK  +
Sbjct:   39 LGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK 181          
BLAST of CK935520 vs. ExPASy Swiss-Prot
Match: ARF3_MOUSE (ADP-ribosylation factor 3 OS=Mus musculus GN=Arf3 PE=2 SV=2)

HSP 1 Score: 194.897 bits (494), Expect = 4.319e-49
Identity = 85/143 (59.44%), Postives = 114/143 (79.72%), Query Frame = 3
Query:    9 IGEVLSTVPTIGFNVEKVQYKNVIFTVWDVGGQEKLRPLWRHYFNNTDGLIYVVDSLDRERIGKAKQEFQAIIKDPFMLNSVILVFANKQDMKGAMTPMEVCEGLGLFDLKNRKWHIQGTCALKGDGLYEGLDWLASTLKEMR 437
            +GE+++T+PTIGFNVE V+YKN+ FTVWDVGGQ+K+RPLWRHYF NT GLI+VVDS DRER+ +A++E   ++ +  + ++V+LVFANKQD+  AM   E+ + LGL  L++R W+IQ TCA  GDGLYEGLDWLA+ LK  +
Sbjct:   39 LGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK 181          
BLAST of CK935520 vs. ExPASy Swiss-Prot
Match: ARF3_HUMAN (ADP-ribosylation factor 3 OS=Homo sapiens GN=ARF3 PE=1 SV=2)

HSP 1 Score: 194.897 bits (494), Expect = 4.319e-49
Identity = 85/143 (59.44%), Postives = 114/143 (79.72%), Query Frame = 3
Query:    9 IGEVLSTVPTIGFNVEKVQYKNVIFTVWDVGGQEKLRPLWRHYFNNTDGLIYVVDSLDRERIGKAKQEFQAIIKDPFMLNSVILVFANKQDMKGAMTPMEVCEGLGLFDLKNRKWHIQGTCALKGDGLYEGLDWLASTLKEMR 437
            +GE+++T+PTIGFNVE V+YKN+ FTVWDVGGQ+K+RPLWRHYF NT GLI+VVDS DRER+ +A++E   ++ +  + ++V+LVFANKQD+  AM   E+ + LGL  L++R W+IQ TCA  GDGLYEGLDWLA+ LK  +
Sbjct:   39 LGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLANQLKNKK 181          
The following BLAST results are available for this feature:
BLAST of CK935520 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 190
Match NameE-valueIdentityDescription
ARF_DUGJA6.027e-5162.14ADP-ribosylation factor OS=Dugesia japonica PE=2 S... [more]
ARF1_LOCMI6.663e-5061.43ADP-ribosylation factor 1 OS=Locusta migratoria GN... [more]
ARF1_DROME6.663e-5061.43ADP-ribosylation factor 1 OS=Drosophila melanogast... [more]
ARF12_CAEEL8.702e-5062.14ADP-ribosylation factor 1-like 2 OS=Caenorhabditis... [more]
ARF12_CAEBR8.702e-5062.14ADP-ribosylation factor 1-like 2 OS=Caenorhabditis... [more]
ARF3_TAKRU4.319e-4959.44ADP-ribosylation factor 3 OS=Takifugu rubripes GN=... [more]
ARF3_RAT4.319e-4959.44ADP-ribosylation factor 3 OS=Rattus norvegicus GN=... [more]
ARF3_PONAB4.319e-4959.44ADP-ribosylation factor 3 OS=Pongo abelii GN=ARF3 ... [more]
ARF3_MOUSE4.319e-4959.44ADP-ribosylation factor 3 OS=Mus musculus GN=Arf3 ... [more]
ARF3_HUMAN4.319e-4959.44ADP-ribosylation factor 3 OS=Homo sapiens GN=ARF3 ... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit 24 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004554_G08 Developing fruit 24 DAFB Citrus sinensis cDNA clone T24DAB0004_IIIF_G08 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK935520 ID=CK935520|Name=CK935520|organism=Citrus sinensis|type=EST|length=795bp
GGGTGCACATTGGTGAAGTTTTATCTACTGTTCCTACTATTGGTTTTAAT
GTCGAGAAAGTTCAGTATAAGAATGTCATATTCACTGTTTGGGATGTTGG
CGGACAAGAGAAATTGAGGCCACTATGGAGGCATTATTTTAATAACACTG
ATGGACTGATCTATGTTGTTGACTCCTTGGACCGGGAGAGAATTGGTAAA
GCAAAGCAAGAATTTCAGGCCATTATCAAAGATCCTTTTATGCTGAACAG
TGTCATTTTGGTGTTTGCCAATAAACAGGACATGAAAGGAGCAATGACCC
CAATGGAAGTATGTGAAGGATTAGGTCTCTTTGATCTCAAGAACAGGAAA
TGGCATATTCAAGGGACTTGTGCACTTAAAGGAGATGGACTTTACGAAGG
CTTGGATTGGTTGGCTTCAACACTTAAGGAGATGAGAGCTGCTGGATACT
CTTCAGTGGGCACCTCATCATTCTAGGGATCCAGGTTTACACGAGAGGAT
TTGAGGTAGATTGAATGATGAAACTCCTGAGTCATGCGTTTACTGGAGGG
AAGTCCCGTCTGTAATCAAATTCTTTTGGGTTGTATGTATCTAAGGCCAA
TGAAGCTTTTGATAGGGTGCTTACATTTGACCGTACTTGTTTGTGTGACT
TCCTGTAATGTATATTGAAGTGAACTGGACTCGGGGTTCAATACATGTCC
TTTATCCTCCTAAGATTCAAAATATGAGTTAAATCGCACACGCACGGGCA
CAGACACGTGTGCTTACCAGTGTGGTGGTGTAGGATAATTGAATC
back to top