CK935524

Overview
NameCK935524
Unique NameCK935524
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length893
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CK935524_ssr65 microsatellite CK935524_ssr65:65..82. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig2619 contig Csv1_Contig2619:1..878. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CK935524 vs. ExPASy Swiss-Prot
Match: ARGB_SYNY3 (Acetylglutamate kinase OS=Synechocystis sp. (strain PCC 6803) GN=argB PE=3 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 1.981e-56
Identity = 118/185 (63.78%), Postives = 137/185 (74.05%), Query Frame = 2
Query:  281 AEFRVDILSESLPFIQKFRGKTIVVKYGGAAMKPNQKDNXXXXXXXXXXXXXXXXXRPVLVHGGGPEINFWLKRFGIEPVFRDGLRVTDANTMEIVSMVLVGRVNKSLVSLINKAGATAVGLSGMDGRLFTARPSPNSDKLGFVGEVARVDPTVIEPLVNSGHIPVIASVAADEFGQSYNINADT 835
            A  RV ILSE+LP+IQ F G+T+VVKYGGAAMK +   N                 RPV+VHGGGPEIN WL + GIEP F+DGLRVTDA TM+IV MVLVGRVNK LV+LIN+AG  AVGL G DG+L TAR   N D +GFVGEV+ VD  V+E LV SG+IPVI+SVAADEFGQ++NINADT
Sbjct:   12 AATRVKILSEALPYIQHFAGRTVVVKYGGAAMKDS---NLKDKVIRDIVFMASVGIRPVVVHGGGPEINTWLDKVGIEPQFKDGLRVTDAATMDIVEMVLVGRVNKELVNLINQAGGKAVGLCGKDGQLMTARTMTNKD-VGFVGEVSSVDARVVETLVKSGYIPVISSVAADEFGQAHNINADT 192          
BLAST of CK935524 vs. ExPASy Swiss-Prot
Match: ARGB_MICAN (Acetylglutamate kinase OS=Microcystis aeruginosa (strain NIES-843) GN=argB PE=3 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 2.587e-56
Identity = 116/184 (63.04%), Postives = 140/184 (76.09%), Query Frame = 2
Query:  290 RVDILSESLPFIQKFRGKTIVVKYGGAAMKPNQ-KDNXXXXXXXXXXXXXXXXXRPVLVHGGGPEINFWLKRFGIEPVFRDGLRVTDANTMEIVSMVLVGRVNKSLVSLINKAGATAVGLSGMDGRLFTARPSPNSDKLGFVGEVARVDPTVIEPLVNSGHIPVIASVAADEFGQSYNINADTV 838
            RV ILSE+LP+IQ+FRG+T+VVKYGGAAM  +  KD                  RPV+VHGGGPEIN WL + GIEP F+DGLRVTDA+TM++V MVLVGRVNK +V+LIN+AG  AVGL G DG L TARP    + +GFVGEV+ VD +V+E LVNSG+IPVI+SVAADE GQ++NINADTV
Sbjct:   12 RVKILSEALPYIQEFRGRTVVVKYGGAAMNNSDIKDTVMRDIVFLSCVGV----RPVIVHGGGPEINSWLDKLGIEPQFKDGLRVTDADTMDVVEMVLVGRVNKEIVALINQAGGKAVGLCGKDGNLITARP-VGKEGIGFVGEVSSVDTSVVESLVNSGYIPVISSVAADETGQAHNINADTV 190          
BLAST of CK935524 vs. ExPASy Swiss-Prot
Match: ARGB_ACAM1 (Acetylglutamate kinase OS=Acaryochloris marina (strain MBIC 11017) GN=argB PE=3 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 1.419e-54
Identity = 112/186 (60.22%), Postives = 134/186 (72.04%), Query Frame = 2
Query:  281 AEFRVDILSESLPFIQKFRGKTIVVKYGGAAMKPNQKDNXXXXXXXXXXXXXXXXXRPVLVHGGGPEINFWLKRFGIEPVFRDGLRVTDANTMEIVSMVLVGRVNKSLVSLINKAGATAVGLSGMDGRLFTARPSPNSDKLGFVGEVARVDPTVIEPLVNSGHIPVIASVAADEFGQSYNINADTV 838
            A  RV +LSE+LP+IQ F G+T+VVKYGGAAMK +                     RPVLVHGGGPEIN WL++ GIEP F  GLRVTDA TM++V MVLVGRVNK LVSLIN+AG +AVG+ G DG+L TARP   S  +GFVGEVA V+P +I  L++ GHIP+++SVA DE GQ YNINADTV
Sbjct:    4 ASDRVQVLSEALPYIQSFAGRTVVVKYGGAAMKDS---TLKATVIRDVVFMACVGLRPVLVHGGGPEINLWLEKLGIEPQFMKGLRVTDAPTMDVVEMVLVGRVNKELVSLINQAGGSAVGVCGKDGKLLTARPQGESG-IGFVGEVASVNPQLIHNLLDGGHIPIVSSVATDEEGQVYNINADTV 185          
BLAST of CK935524 vs. ExPASy Swiss-Prot
Match: ARGB_NOSP7 (Acetylglutamate kinase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=argB PE=3 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 2.677e-53
Identity = 108/184 (58.70%), Postives = 138/184 (75.00%), Query Frame = 2
Query:  290 RVDILSESLPFIQKFRGKTIVVKYGGAAMKPNQ-KDNXXXXXXXXXXXXXXXXXRPVLVHGGGPEINFWLKRFGIEPVFRDGLRVTDANTMEIVSMVLVGRVNKSLVSLINKAGATAVGLSGMDGRLFTARPSPNSDKLGFVGEVARVDPTVIEPLVNSGHIPVIASVAADEFGQSYNINADTV 838
            RV +LSE+LP+IQ+F G+T+VVKYGGAAMK +  KD                  RP++VHGGGPEIN WL + GIEP F++GLRVTDA TM++V MVLVGRVNK +V+LIN+AG  AVGL G DG LFTARP    + +GFVGEV+ V+  +++ L ++G+IPV++SVAADE GQ+YNINADTV
Sbjct:   16 RVRVLSEALPYIQQFAGRTVVVKYGGAAMKDSTLKDKVIRDIVFLSCVGL----RPIVVHGGGPEINSWLDKLGIEPQFKNGLRVTDAATMDVVEMVLVGRVNKEIVALINQAGGLAVGLCGKDGNLFTARPQ-GQEGIGFVGEVSNVNIKILDTLASNGYIPVVSSVAADETGQAYNINADTV 194          
BLAST of CK935524 vs. ExPASy Swiss-Prot
Match: ARGB_SYNP6 (Acetylglutamate kinase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=argB PE=3 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 1.017e-52
Identity = 111/183 (60.66%), Postives = 132/183 (72.13%), Query Frame = 2
Query:  290 RVDILSESLPFIQKFRGKTIVVKYGGAAMKPNQKDNXXXXXXXXXXXXXXXXXRPVLVHGGGPEINFWLKRFGIEPVFRDGLRVTDANTMEIVSMVLVGRVNKSLVSLINKAGATAVGLSGMDGRLFTARPSPNSDKLGFVGEVARVDPTVIEPLVNSGHIPVIASVAADEFGQSYNINADTV 838
            RV ILSE+LP++Q+F G+T+VVKYGGAAMK   ++                  RPV+VHGGGPEIN WL R GIEP F +GLRVTDA+TME+V MVLVGRVNK +VS IN  G  AVG  G DGRL  ARP  + + +GFVGEV  V+  VIEPL+  G+IPVI+SVAADE GQS+NINADTV
Sbjct:   13 RVRILSEALPYLQQFAGRTVVVKYGGAAMK---QEELKEAVMRDIVFLACVGMRPVVVHGGGPEINAWLGRVGIEPQFHNGLRVTDADTMEVVEMVLVGRVNKDIVSRINTTGGRAVGFCGTDGRLVLARPH-DQEGIGFVGEVNSVNSEVIEPLLERGYIPVISSVAADENGQSFNINADTV 191          
BLAST of CK935524 vs. ExPASy Swiss-Prot
Match: ARGB_SYNE7 (Acetylglutamate kinase OS=Synechococcus elongatus (strain PCC 7942) GN=argB PE=1 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 1.017e-52
Identity = 111/183 (60.66%), Postives = 132/183 (72.13%), Query Frame = 2
Query:  290 RVDILSESLPFIQKFRGKTIVVKYGGAAMKPNQKDNXXXXXXXXXXXXXXXXXRPVLVHGGGPEINFWLKRFGIEPVFRDGLRVTDANTMEIVSMVLVGRVNKSLVSLINKAGATAVGLSGMDGRLFTARPSPNSDKLGFVGEVARVDPTVIEPLVNSGHIPVIASVAADEFGQSYNINADTV 838
            RV ILSE+LP++Q+F G+T+VVKYGGAAMK   ++                  RPV+VHGGGPEIN WL R GIEP F +GLRVTDA+TME+V MVLVGRVNK +VS IN  G  AVG  G DGRL  ARP  + + +GFVGEV  V+  VIEPL+  G+IPVI+SVAADE GQS+NINADTV
Sbjct:   13 RVRILSEALPYLQQFAGRTVVVKYGGAAMK---QEELKEAVMRDIVFLACVGMRPVVVHGGGPEINAWLGRVGIEPQFHNGLRVTDADTMEVVEMVLVGRVNKDIVSRINTTGGRAVGFCGTDGRLVLARPH-DQEGIGFVGEVNSVNSEVIEPLLERGYIPVISSVAADENGQSFNINADTV 191          
BLAST of CK935524 vs. ExPASy Swiss-Prot
Match: ARGB_ANAVT (Acetylglutamate kinase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=argB PE=3 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 1.017e-52
Identity = 108/184 (58.70%), Postives = 136/184 (73.91%), Query Frame = 2
Query:  290 RVDILSESLPFIQKFRGKTIVVKYGGAAMKPNQ-KDNXXXXXXXXXXXXXXXXXRPVLVHGGGPEINFWLKRFGIEPVFRDGLRVTDANTMEIVSMVLVGRVNKSLVSLINKAGATAVGLSGMDGRLFTARPSPNSDKLGFVGEVARVDPTVIEPLVNSGHIPVIASVAADEFGQSYNINADTV 838
            RV +LSE+LP+IQ+F G+T+VVKYGGAAMK +  KD                  RP+LVHGGGPEIN WL + GIE  F++GLRVTDA TM++V MVLVGRVNK +VSLIN+AG  AVGL G DG L TARP    + +GFVGEV+ V+  ++E L ++G+IPV++SVAAD+ GQ+YNINADTV
Sbjct:   16 RVQVLSEALPYIQQFAGRTVVVKYGGAAMKDSHLKDQVIRDIVFLSCVGL----RPILVHGGGPEINSWLDKLGIEAQFKNGLRVTDAPTMDVVEMVLVGRVNKEIVSLINQAGGLAVGLCGKDGNLITARPQ-GQEGIGFVGEVSNVNIKILETLASNGYIPVVSSVAADDSGQAYNINADTV 194          
BLAST of CK935524 vs. ExPASy Swiss-Prot
Match: ARGB_ANASP (Acetylglutamate kinase OS=Anabaena sp. (strain PCC 7120) GN=argB PE=3 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 1.017e-52
Identity = 108/184 (58.70%), Postives = 136/184 (73.91%), Query Frame = 2
Query:  290 RVDILSESLPFIQKFRGKTIVVKYGGAAMKPNQ-KDNXXXXXXXXXXXXXXXXXRPVLVHGGGPEINFWLKRFGIEPVFRDGLRVTDANTMEIVSMVLVGRVNKSLVSLINKAGATAVGLSGMDGRLFTARPSPNSDKLGFVGEVARVDPTVIEPLVNSGHIPVIASVAADEFGQSYNINADTV 838
            RV +LSE+LP+IQ+F G+T+VVKYGGAAMK +  KD                  RP+LVHGGGPEIN WL + GIE  F++GLRVTDA TM++V MVLVGRVNK +VSLIN+AG  AVGL G DG L TARP    + +GFVGEV+ V+  ++E L ++G+IPV++SVAAD+ GQ+YNINADTV
Sbjct:   16 RVQVLSEALPYIQQFAGRTVVVKYGGAAMKDSHLKDQVIRDIVFLSCVGL----RPILVHGGGPEINSWLDKLGIEAQFKNGLRVTDAPTMDVVEMVLVGRVNKEIVSLINQAGGLAVGLCGKDGNLITARPQ-GQEGIGFVGEVSNVNIKILETLASNGYIPVVSSVAADDSGQAYNINADTV 194          
BLAST of CK935524 vs. ExPASy Swiss-Prot
Match: ARGB_TRIEI (Acetylglutamate kinase OS=Trichodesmium erythraeum (strain IMS101) GN=argB PE=3 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 3.866e-52
Identity = 108/193 (55.96%), Postives = 138/193 (71.50%), Query Frame = 2
Query:  263 TDTQTPAEF-RVDILSESLPFIQKFRGKTIVVKYGGAAMKPNQKDNXXXXXXXXXXXXXXXXXRPVLVHGGGPEINFWLKRFGIEPVFRDGLRVTDANTMEIVSMVLVGRVNKSLVSLINKAGATAVGLSGMDGRLFTARPSPNSDKLGFVGEVARVDPTVIEPLVNSGHIPVIASVAADEFGQSYNINADTV 838
            TD +  +E  RV +LSE+LP+IQKF G+ IVVKYGGAAM+ +   N                 RP++VHGGGPEIN WL + GIEP F+DGLRVTDA+TME+V MVLVG+VNK +VSLIN+AG  AVGL G D  L  ARP    + +GFVGEV+ V   +++ LV++G+IPV++SVA DE GQ+YN+NADTV
Sbjct:    5 TDLKNESEMSRVKVLSEALPYIQKFTGRKIVVKYGGAAMRDS---NVKDQVMRDIVLLSCVGIRPIVVHGGGPEINSWLGKLGIEPQFKDGLRVTDASTMEVVEMVLVGKVNKEIVSLINQAGGCAVGLCGKDASLIQARPE-GIEGIGFVGEVSNVKIDILQSLVDNGYIPVVSSVATDEQGQAYNLNADTV 193          
BLAST of CK935524 vs. ExPASy Swiss-Prot
Match: ARGB_THEEB (Acetylglutamate kinase OS=Thermosynechococcus elongatus (strain BP-1) GN=argB PE=3 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 5.582e-51
Identity = 109/184 (59.24%), Postives = 131/184 (71.20%), Query Frame = 2
Query:  290 RVDILSESLPFIQKFRGKTIVVKYGGAAMKPNQ-KDNXXXXXXXXXXXXXXXXXRPVLVHGGGPEINFWLKRFGIEPVFRDGLRVTDANTMEIVSMVLVGRVNKSLVSLINKAGATAVGLSGMDGRLFTARPSPNSDKLGFVGEVARVDPTVIEPLVNSGHIPVIASVAADEFGQSYNINADTV 838
            RV +LSE+LP++Q F G+T VVKYGGAAMK  Q KD+                 RPV+VHGGGPEIN WL +  IEP F++GLRVTDA TM++V MVLVGRVNK +V+LIN+AG  AVGL G DG L  AR +   + +GFVGEV  VD  VI  LV  G+IPVI+SVAAD+ GQ+YNINADTV
Sbjct:    7 RVRVLSEALPYLQAFAGRTFVVKYGGAAMKEEQLKDSVIRDIVFLSYVGI----RPVVVHGGGPEINTWLAKLNIEPQFKNGLRVTDAATMDVVEMVLVGRVNKEIVTLINQAGGQAVGLCGKDGNLIRAR-AKGEESIGFVGEVQGVDTRVITALVEKGYIPVISSVAADDTGQAYNINADTV 185          
The following BLAST results are available for this feature:
BLAST of CK935524 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
ARGB_SYNY31.981e-5663.78Acetylglutamate kinase OS=Synechocystis sp. (strai... [more]
ARGB_MICAN2.587e-5663.04Acetylglutamate kinase OS=Microcystis aeruginosa (... [more]
ARGB_ACAM11.419e-5460.22Acetylglutamate kinase OS=Acaryochloris marina (st... [more]
ARGB_NOSP72.677e-5358.70Acetylglutamate kinase OS=Nostoc punctiforme (stra... [more]
ARGB_SYNP61.017e-5260.66Acetylglutamate kinase OS=Synechococcus sp. (strai... [more]
ARGB_SYNE71.017e-5260.66Acetylglutamate kinase OS=Synechococcus elongatus ... [more]
ARGB_ANAVT1.017e-5258.70Acetylglutamate kinase OS=Anabaena variabilis (str... [more]
ARGB_ANASP1.017e-5258.70Acetylglutamate kinase OS=Anabaena sp. (strain PCC... [more]
ARGB_TRIEI3.866e-5255.96Acetylglutamate kinase OS=Trichodesmium erythraeum... [more]
ARGB_THEEB5.582e-5159.24Acetylglutamate kinase OS=Thermosynechococcus elon... [more]

Pages

back to top
Libraries
Library NameType
Developing fruit 24 DAFBcdna_library
Properties
Property NameValue
Genbank descriptionCGF1004554_F05 Developing fruit 24 DAFB Citrus sinensis cDNA clone T24DAB0004_IIIF_F05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CK935524 ID=CK935524|Name=CK935524|organism=Citrus sinensis|type=EST|length=893bp
GGGGCTGCCCGAAGTGAGGAAGGAAGAGTCTCTCTGAACCCAAGCAATAT
CTGCGGAGAATATGGCCGCCGCCGCCGCCGCCTCCCTAGAAATTGCTCCT
TTTTTACAGTCACAGCTTTCATTCTCATCAAAGTCAAAAGCAGGCTCTCA
TTCTCCCTCCATCTTCAAAATCAAAACCCCACATGTCGAGAATTTCGCTT
CGAACCACCGCACCGAAATAACAAAATCATCCCGCTCTCTCACATCAGCA
GCAACAGCCGTAACTGACACACAGACCCCAGCCGAGTTCCGTGTCGACAT
TCTTTCCGAATCTCTTCCCTTCATTCAGAAATTCCGCGGAAAGACCATCG
TCGTCAAATACGGCGGCGCCGCTATGAAACCCAACCAAAAGGACAACCTC
CTCGCCTCCGTCGTAAAAGACCTCGTTCTCCTGTCCGTTGTGGGACTCCG
TCCTGTCTTGGTCCACGGCGGCGGTCCTGAGATCAATTTCTGGCTTAAAC
GTTTCGGAATCGAGCCCGTTTTCCGTGACGGCCTCCGCGTCACTGATGCC
AACACTATGGAGATCGTGTCCATGGTTCTGGTGGGGAGGGTGAACAAGAG
CTTGGTTTCTCTCATCAACAAAGCCGGCGCCACCGCGGTTGGGCTCTCGG
GCATGGACGGGCGCCTCTTCACGGCCCGGCCCAGCCCAAACTCCGATAAA
CTGGGTTTCGTTGGTGAGGTAGCCCGCGTGGACCCCACGGTCATTGAGCC
TCTGGTAAACAGTGGACACATACCAGTGATTGCTTCTGTGGCTGCGGATG
AGTTTGGGCAATCTTATAACATCAATGCGGACACTGTGGCTGGGGAACTG
GCGGCGGCATTGGGTGCTGAGAAGCTGATATTGTTGACTGATG
back to top