CK935598
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CK935598 vs. ExPASy Swiss-Prot
Match: MT3_CARPA (Metallothionein-like protein type 3 OS=Carica papaya PE=3 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 5.101e-19 Identity = 33/47 (70.21%), Postives = 39/47 (82.98%), Query Frame = 2 Query: 95 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAE 235 MSDTCGNCDCAD++QCVKKGSSY AD +ET+ S ++ VVMD AAE Sbjct: 1 MSDTCGNCDCADKTQCVKKGSSYTADIIETEKSIMT--VVMDAPAAE 45 HSP 2 Score: 41.9726 bits (97), Expect = 5.101e-19 Identity = 13/17 (76.47%), Postives = 15/17 (88.24%), Query Frame = 1 Query: 241 GNCKCGPTCACVNCTCG 291 G CKCGP+C+C NCTCG Sbjct: 48 GKCKCGPSCSCTNCTCG 64
BLAST of CK935598 vs. ExPASy Swiss-Prot
Match: MT3_ACTDE (Metallothionein-like protein type 3 OS=Actinidia deliciosa GN=pKIWI503 PE=2 SV=1) HSP 1 Score: 61.2326 bits (147), Expect = 1.426e-14 Identity = 32/48 (66.67%), Postives = 36/48 (75.00%), Query Frame = 2 Query: 95 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAET 238 MSD CGNCDCAD SQCVKKG+S D VETD S++ VVM V AAE+ Sbjct: 1 MSDKCGNCDCADSSQCVKKGNS--IDIVETDKSYIED-VVMGVPAAES 45 HSP 2 Score: 37.3502 bits (85), Expect = 1.426e-14 Identity = 12/16 (75.00%), Postives = 13/16 (81.25%), Query Frame = 1 Query: 241 GNCKCGPTCACVNCTC 288 G CKCG +C CVNCTC Sbjct: 47 GKCKCGTSCPCVNCTC 62
BLAST of CK935598 vs. ExPASy Swiss-Prot
Match: MT3_MUSAC (Metallothionein-like protein type 3 OS=Musa acuminata PE=3 SV=1) HSP 1 Score: 62.3882 bits (150), Expect = 1.853e-14 Identity = 28/44 (63.64%), Postives = 34/44 (77.27%), Query Frame = 2 Query: 104 TCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAE 235 TCGNCDC D+SQCVKKG+SY D VET+ S+V V+V +AAE Sbjct: 3 TCGNCDCVDKSQCVKKGNSYGIDIVETEKSYVDEVIVA-AEAAE 45 HSP 2 Score: 35.8094 bits (81), Expect = 1.853e-14 Identity = 11/18 (61.11%), Postives = 13/18 (72.22%), Query Frame = 1 Query: 241 GNCKCGPTCACVNCTCGS 294 G CKCG CAC +C CG+ Sbjct: 48 GKCKCGAACACTDCKCGN 65
BLAST of CK935598 vs. ExPASy Swiss-Prot
Match: MT3_PRUAV (Metallothionein-like protein 1 OS=Prunus avium GN=MT1 PE=3 SV=1) HSP 1 Score: 50.8322 bits (120), Expect = 2.065e-12 Identity = 25/47 (53.19%), Postives = 30/47 (63.83%), Query Frame = 2 Query: 95 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAE 235 MS C NCDC+D SQC KKG S+ VET+ + T V+MD AAE Sbjct: 1 MSSKCSNCDCSDSSQCTKKGYSFDLVIVETENRSMDT-VIMDAPAAE 46 HSP 2 Score: 40.4318 bits (93), Expect = 2.065e-12 Identity = 13/16 (81.25%), Postives = 15/16 (93.75%), Query Frame = 1 Query: 241 GNCKCGPTCACVNCTC 288 GNCKCGP+CACV+C C Sbjct: 49 GNCKCGPSCACVDCKC 64
BLAST of CK935598 vs. ExPASy Swiss-Prot
Match: MT3A_ORYSJ (Metallothionein-like protein 3A OS=Oryza sativa subsp. japonica GN=MT3A PE=2 SV=1) HSP 1 Score: 55.4546 bits (132), Expect = 4.539e-12 Identity = 24/38 (63.16%), Postives = 27/38 (71.05%), Query Frame = 2 Query: 95 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTV 208 MSD CGNCDCAD+SQCVKKG+SY VE + S V Sbjct: 1 MSDKCGNCDCADKSQCVKKGTSYGVVIVEAEKSHFEEV 38 HSP 2 Score: 34.6538 bits (78), Expect = 4.539e-12 Identity = 10/17 (58.82%), Postives = 13/17 (76.47%), Query Frame = 1 Query: 241 GNCKCGPTCACVNCTCG 291 G CKCG +C+C +C CG Sbjct: 45 GGCKCGTSCSCTDCKCG 61
BLAST of CK935598 vs. ExPASy Swiss-Prot
Match: MT3A_ORYSI (Metallothionein-like protein 3A OS=Oryza sativa subsp. indica GN=MT3A PE=3 SV=1) HSP 1 Score: 55.4546 bits (132), Expect = 4.539e-12 Identity = 24/38 (63.16%), Postives = 27/38 (71.05%), Query Frame = 2 Query: 95 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTV 208 MSD CGNCDCAD+SQCVKKG+SY VE + S V Sbjct: 1 MSDKCGNCDCADKSQCVKKGTSYGVVIVEAEKSHFEEV 38 HSP 2 Score: 34.6538 bits (78), Expect = 4.539e-12 Identity = 10/17 (58.82%), Postives = 13/17 (76.47%), Query Frame = 1 Query: 241 GNCKCGPTCACVNCTCG 291 G CKCG +C+C +C CG Sbjct: 45 GGCKCGTSCSCTDCKCG 61
BLAST of CK935598 vs. ExPASy Swiss-Prot
Match: MT3_MALDO (Metallothionein-like protein type 3 OS=Malus domestica GN=MT2 PE=3 SV=1) HSP 1 Score: 52.373 bits (124), Expect = 5.861e-12 Identity = 27/47 (57.45%), Postives = 31/47 (65.96%), Query Frame = 2 Query: 95 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAE 235 MS C NCDCAD +QCVKKG+SY VET+ + TV V D AAE Sbjct: 1 MSGKCDNCDCADSTQCVKKGNSYDLVIVETENRSMDTVFV-DAPAAE 46 HSP 2 Score: 37.3502 bits (85), Expect = 5.861e-12 Identity = 12/17 (70.59%), Postives = 14/17 (82.35%), Query Frame = 1 Query: 241 GNCKCGPTCACVNCTCG 291 G CKCG C+CV+CTCG Sbjct: 49 GKCKCGTGCSCVSCTCG 65 The following BLAST results are available for this feature:
BLAST of CK935598 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 7
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CK935598 ID=CK935598; Name=CK935598; organism=Citrus sinensis; type=EST; length=598bpback to top |