EY735569

Overview
NameEY735569
Unique NameEY735569
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length832
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3341 contig Csv1_Contig3341:534..1365. BLAST: Citrus Unigene V1 Contigs to Populus V2 proteins
Homology
BLAST of EY735569 vs. ExPASy Swiss-Prot
Match: GOGC1_ARATH (Golgin candidate 1 OS=Arabidopsis thaliana GN=GC1 PE=2 SV=2)

HSP 1 Score: 357.836 bits (917), Expect = 4.188e-98
Identity = 187/272 (68.75%), Postives = 220/272 (80.88%), Query Frame = 1
Query:    4 RVRELLVAERELSRSYEARIKQLEQELSVYKSEVTKVESNLAEALAAKNSEIETLVSSIDALKKQAALSEGNLASLQMNMESIMRNRELTETRMIQXXXXXXXXXXXXXXXXXXXHNATKMAAMEREVELEHRAAEASMALARIQRIADERTAKAGELEQKVAMLEVECATLQQELQDMEARLKRGQKKSPEEANQAIQMQAWQDEVERARQGQRDAENKLSSLEAEVQKMRVEMAAMKRDADHYPVEEHMEIEKRLRGPTNLLYYKPTQLE 819
            ++ ELL AE+EL++SYEA I+ L+++LS  KSEVTKVES++ EALAAKNSEIETLVS++DALK QAAL+EG L+SLQ +MESIMRNREL ETRM+Q                   HNATKMAAMERE ELEHRA +AS AL RIQRIADERTAK  + EQKVA+LE EC +L QELQDME R +RGQKK+P+EANQ IQ+QAWQDEV+RARQGQRDAE KLS +EAE+QK+RVEMAAMKRDA+HY  +EH E+EKR R  T+LLYYK TQLE
Sbjct:  305 QLEELLTAEQELTKSYEASIRHLQKDLSAAKSEVTKVESSMVEALAAKNSEIETLVSAMDALKNQAALNEGKLSSLQGDMESIMRNRELAETRMMQALREELATTERRAEEERSAHNATKMAAMERERELEHRAVDASTALVRIQRIADERTAKVADFEQKVALLEAECTSLNQELQDMEVRARRGQKKAPDEANQVIQIQAWQDEVDRARQGQRDAEEKLSLMEAEMQKLRVEMAAMKRDAEHYSRQEHTELEKRYRELTDLLYYKQTQLE 576          
BLAST of EY735569 vs. ExPASy Swiss-Prot
Match: GOGA5_ORYSJ (Golgin-84 OS=Oryza sativa subsp. japonica GN=Os01g0744400 PE=2 SV=1)

HSP 1 Score: 328.176 bits (840), Expect = 3.554e-89
Identity = 174/273 (63.74%), Postives = 214/273 (78.39%), Query Frame = 1
Query:    4 RVRELLVAERELSRSYEARIKQLEQELSVYKSEVTKVESNLAEALAAKNSEIETLVSSIDALKKQAALSEGNLASLQMNMESIMRNRELTETRMIQXXXXXXXXXXXXXXXXXXXHNATKMAAMEREVELEHRAAEASMALARIQRIADERTAKAGELEQKVAMLEVECATLQQELQDMEARLKRGQKKSPEEANQAIQMQAWQDEVERARQGQRDAENKLSSLEAEVQKMRVEMAAMKRDADHYPVEEHMEIEKRLRGPTNLLYYKPTQLEN 822
            ++ ELLV ERE   SYEA +KQL+QELS+ + E ++ ESN+ +AL AKN+EIE+LV S+D+ KK+AA SE  LA+LQ +M+ + RNRELTETR+IQ                   HNATKMAA+EREVELEHRA EAS ALARIQR AD+ +++A ELE KVA+LEVECA+LQQELQ+MEAR +R QKK  EEANQ IQMQAWQ+EVERARQ QR+AE K+SSLEAE+QKMRVEMA MKRDA+HY  +EH+E+EKR R  T+LLY+K TQLE+
Sbjct:  305 QLEELLVQEREKCSSYEAHMKQLQQELSMSRVEGSRAESNMVDALTAKNAEIESLVKSLDSWKKKAAASEEKLAALQEDMDGLKRNRELTETRVIQALREELATVERRAEEERIAHNATKMAAVEREVELEHRAVEASNALARIQRAADQSSSRAMELEHKVAVLEVECASLQQELQEMEARNRRAQKKPSEEANQVIQMQAWQEEVERARQSQREAETKISSLEAELQKMRVEMAGMKRDAEHYSRQEHVELEKRYRELTDLLYHKQTQLES 577          
The following BLAST results are available for this feature:
BLAST of EY735569 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
GOGC1_ARATH4.188e-9868.75Golgin candidate 1 OS=Arabidopsis thaliana GN=GC1 ... [more]
GOGA5_ORYSJ3.554e-8963.74Golgin-84 OS=Oryza sativa subsp. japonica GN=Os01g... [more]
back to top
Libraries
Library NameType
Sweet orange fruit, development stadium (6 of 6)cdna_library
Properties
Property NameValue
Genbank descriptionCS00-C3-705-001-C05-CT.F Sweet orange fruit, development stadium (6 of 6) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY735569 ID=EY735569|Name=EY735569|organism=Citrus sinensis|type=EST|length=832bp
CCACGCGTCCGGGAACTTCTTGTTGCGGAGAGAGAGCTGAGTAGATCATA
TGAGGCTCGCATAAAACAGCTAGAGCAAGAATTATCTGTATATAAAAGTG
AGGTAACGAAGGTGGAGTCAAACCTGGCTGAGGCTTTGGCAGCAAAGAAC
TCTGAAATTGAGACACTCGTCAGTTCTATAGATGCACTTAAGAAACAGGC
TGCTTTATCTGAAGGAAATTTGGCTTCACTTCAGATGAACATGGAATCCA
TTATGAGAAATAGAGAGTTAACAGAGACTAGGATGATACAGGCTTTACGG
GAGGAGCTTGCCTCTGTAGAAAGGAGAGCAGAAGAAGAGCGTGCAGCACA
TAATGCTACCAAAATGGCTGCTATGGAAAGGGAAGTGGAATTGGAACATA
GAGCTGCTGAGGCATCAATGGCCCTTGCTAGGATACAGAGAATTGCAGAT
GAGAGGACAGCCAAGGCTGGGGAGCTTGAGCAGAAAGTGGCTATGCTTGA
GGTTGAATGTGCAACTTTACAACAAGAACTACAAGATATGGAAGCTCGTC
TTAAGCGTGGACAAAAGAAGTCCCCTGAAGAAGCAAATCAAGCAATTCAG
ATGCAGGCATGGCAGGATGAAGTGGAACGTGCACGTCAGGGTCAGAGAGA
TGCTGAAAACAAGCTTTCTTCTTTGGAGGCTGAAGTGCAAAAAATGAGAG
TTGAAATGGCGGCCATGAAGAGGGATGCGGACCATTATCCAGTTGAGGAA
CATATGGAAATAGAGAAACGCCTACGGGGACCTACAAATCTTTTGTACTA
CAAGCCAACACAGCTTGAAAACCATGGCCATT
back to top