EY735559

Overview
NameEY735559
Unique NameEY735559
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length482
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2614 contig Csv1_Contig2614:199..679. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY735559 vs. ExPASy Swiss-Prot
Match: MT3_CARPA (Metallothionein-like protein type 3 OS=Carica papaya PE=3 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 4.256e-23
Identity = 45/65 (69.23%), Postives = 54/65 (83.08%), Query Frame = 3
Query:   12 SDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG 206
            SDTCGNCDCAD++QCVKKGSSY AD +ET+ S ++  VVMD  AAE +G CKCGP+C+C NCTCG
Sbjct:    2 SDTCGNCDCADKTQCVKKGSSYTADIIETEKSIMT--VVMDAPAAENDGKCKCGPSCSCTNCTCG 64          
BLAST of EY735559 vs. ExPASy Swiss-Prot
Match: MT3_MUSAC (Metallothionein-like protein type 3 OS=Musa acuminata PE=3 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 4.869e-19
Identity = 39/64 (60.94%), Postives = 48/64 (75.00%), Query Frame = 3
Query:   18 TCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCGS 209
            TCGNCDC D+SQCVKKG+SY  D VET+ S+V  V+V   +AAE +G CKCG  CAC +C CG+
Sbjct:    3 TCGNCDCVDKSQCVKKGNSYGIDIVETEKSYVDEVIVA-AEAAEHDGKCKCGAACACTDCKCGN 65          
BLAST of EY735559 vs. ExPASy Swiss-Prot
Match: MT3_ACTDE (Metallothionein-like protein type 3 OS=Actinidia deliciosa GN=pKIWI503 PE=2 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 2.416e-18
Identity = 43/64 (67.19%), Postives = 48/64 (75.00%), Query Frame = 3
Query:   12 SDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTC 203
            SD CGNCDCAD SQCVKKG+S   D VETD S++  VV M V AAE+ G CKCG +C CVNCTC
Sbjct:    2 SDKCGNCDCADSSQCVKKGNSI--DIVETDKSYIEDVV-MGVPAAESGGKCKCGTSCPCVNCTC 62          
BLAST of EY735559 vs. ExPASy Swiss-Prot
Match: MT3_PRUAV (Metallothionein-like protein 1 OS=Prunus avium GN=MT1 PE=3 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 6.581e-16
Identity = 37/64 (57.81%), Postives = 44/64 (68.75%), Query Frame = 3
Query:   12 SDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTC 203
            S  C NCDC+D SQC KKG S+    VET+   + TV+ MD  AAE  GNCKCGP+CACV+C C
Sbjct:    2 SSKCSNCDCSDSSQCTKKGYSFDLVIVETENRSMDTVI-MDAPAAENGGNCKCGPSCACVDCKC 64          
BLAST of EY735559 vs. ExPASy Swiss-Prot
Match: MT3_MALDO (Metallothionein-like protein type 3 OS=Malus domestica GN=MT2 PE=3 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 6.581e-16
Identity = 38/65 (58.46%), Postives = 45/65 (69.23%), Query Frame = 3
Query:   12 SDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG 206
            S  C NCDCAD +QCVKKG+SY    VET+   + TV V D  AAE +G CKCG  C+CV+CTCG
Sbjct:    2 SGKCDNCDCADSTQCVKKGNSYDLVIVETENRSMDTVFV-DAPAAEHDGKCKCGTGCSCVSCTCG 65          
BLAST of EY735559 vs. ExPASy Swiss-Prot
Match: MT3A_ORYSJ (Metallothionein-like protein 3A OS=Oryza sativa subsp. japonica GN=MT3A PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 2.501e-15
Identity = 35/65 (53.85%), Postives = 42/65 (64.62%), Query Frame = 3
Query:   12 SDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG 206
            SD CGNCDCAD+SQCVKKG+SY    VE + S        +V A E  G CKCG +C+C +C CG
Sbjct:    2 SDKCGNCDCADKSQCVKKGTSYGVVIVEAEKSHFE-----EVAAGEENGGCKCGTSCSCTDCKCG 61          
BLAST of EY735559 vs. ExPASy Swiss-Prot
Match: MT3A_ORYSI (Metallothionein-like protein 3A OS=Oryza sativa subsp. indica GN=MT3A PE=3 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 2.501e-15
Identity = 35/65 (53.85%), Postives = 42/65 (64.62%), Query Frame = 3
Query:   12 SDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG 206
            SD CGNCDCAD+SQCVKKG+SY    VE + S        +V A E  G CKCG +C+C +C CG
Sbjct:    2 SDKCGNCDCADKSQCVKKGTSYGVVIVEAEKSHFE-----EVAAGEENGGCKCGTSCSCTDCKCG 61          
BLAST of EY735559 vs. ExPASy Swiss-Prot
Match: MT3B_ORYSJ (Metallothionein-like protein 3B OS=Oryza sativa subsp. japonica GN=MT3B PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 3.992e-13
Identity = 32/65 (49.23%), Postives = 40/65 (61.54%), Query Frame = 3
Query:   12 SDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG 206
            SD CGNCDCAD+SQCVKKG+SY    V+ + S     +  +V   E +G CKC   C+C  C CG
Sbjct:    2 SDKCGNCDCADKSQCVKKGTSYGVVIVDAEKSHFE--MAEEVGYEENDGKCKCTTGCSCAGCNCG 64          
BLAST of EY735559 vs. ExPASy Swiss-Prot
Match: MT3B_ORYSI (Metallothionein-like protein 3B OS=Oryza sativa subsp. indica GN=MT3B PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.517e-12
Identity = 31/65 (47.69%), Postives = 40/65 (61.54%), Query Frame = 3
Query:   12 SDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCTCG 206
            SD CG+CDCAD+SQCVKKG+SY    V+ + S     +  +V   E +G CKC   C+C  C CG
Sbjct:    2 SDKCGHCDCADKSQCVKKGTSYGVVIVDAEKSHFE--MAEEVGYEENDGKCKCTTGCSCAGCNCG 64          
The following BLAST results are available for this feature:
BLAST of EY735559 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
MT3_CARPA4.256e-2369.23Metallothionein-like protein type 3 OS=Carica papa... [more]
MT3_MUSAC4.869e-1960.94Metallothionein-like protein type 3 OS=Musa acumin... [more]
MT3_ACTDE2.416e-1867.19Metallothionein-like protein type 3 OS=Actinidia d... [more]
MT3_PRUAV6.581e-1657.81Metallothionein-like protein 1 OS=Prunus avium GN=... [more]
MT3_MALDO6.581e-1658.46Metallothionein-like protein type 3 OS=Malus domes... [more]
MT3A_ORYSJ2.501e-1553.85Metallothionein-like protein 3A OS=Oryza sativa su... [more]
MT3A_ORYSI2.501e-1553.85Metallothionein-like protein 3A OS=Oryza sativa su... [more]
MT3B_ORYSJ3.992e-1349.23Metallothionein-like protein 3B OS=Oryza sativa su... [more]
MT3B_ORYSI1.517e-1247.69Metallothionein-like protein 3B OS=Oryza sativa su... [more]
back to top
Libraries
Library NameType
Sweet orange fruit, development stadium (6 of 6)cdna_library
Properties
Property NameValue
Genbank descriptionCS00-C3-705-001-B04-CT.F Sweet orange fruit, development stadium (6 of 6) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY735559 ID=EY735559|Name=EY735559|organism=Citrus sinensis|type=EST|length=482bp
CACGCGTCCGGTCGGACACCTGCGGCAACTGCGACTGCGCTGACAGGAGC
CAGTGTGTGAAGAAGGGAAGCAGCTATGCTGCTGACTTCGTCGAGACTGA
CTTGAGCTTTGTCAGCACCGTTGTTGTCATGGACGTTCAGGCTGCTGAGG
CTGAAGGTAACTGCAAGTGCGGCCCCACCTGCGCTTGTGTGAACTGCACT
TGTGGTAGTCACTAATAAGCAAACACATGCAGCAAAAAATAAGAAGCTGC
AAGTGTGCCTAAATATTGTGGGGGTTAAGAATAATGTAAGGGTGATTAAA
AAAAAAAAGAAAAATTCTCTACTTCGTTTTTATGATGGTCTACTACTAGT
GTGTGGAGTGATGTGCGTGTTGTGTCACCCATCACTCGTAATGTTTTGTG
TTTCCTTCTTCATAATCATGTAATATATGGCCATGGCCATGACCGTGGCC
TTGTGTGGTTTAATTTTAAAAAAAAAAAAAAA
back to top