EY756575

Overview
NameEY756575
Unique NameEY756575
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length724
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
EY756575_ssr456 microsatellite EY756575_ssr456:456..465. BLAST: Citrus ESTs to Prunus persica proteins V1
EY756575_ssr547 microsatellite EY756575_ssr547:547..558. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig4280 contig Csv1_Contig4280:166..889. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756575 vs. ExPASy Swiss-Prot
Match: CUL4B_HUMAN (Cullin-4B OS=Homo sapiens GN=CUL4B PE=1 SV=3)

HSP 1 Score: 214.157 bits (544), Expect = 5.888e-55
Identity = 104/144 (72.22%), Postives = 120/144 (83.33%), Query Frame = 2
Query:    8 SAGI*HKELRRTLQSLACGKVRVLQKLPKGRDVEDDDSFVFNEGFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLERDKNNPQIYNYLA 439
            + GI   ELRRTLQSLACGK RVL K PKG+D+ED D F+ N+ F   L+RIK+N IQMKETVEE  STTERVFQDRQYQ+DAAIVRIMK RK LSH LL++E++ QLKFP+KPADLKKRIESLIDR+Y+ERDK NP  YNY+A
Sbjct:  752 ATGIEDGELRRTLQSLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTERVFQDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYMERDKENPNQYNYIA 895          
BLAST of EY756575 vs. ExPASy Swiss-Prot
Match: CUL4A_HUMAN (Cullin-4A OS=Homo sapiens GN=CUL4A PE=1 SV=3)

HSP 1 Score: 210.69 bits (535), Expect = 6.510e-54
Identity = 103/144 (71.53%), Postives = 119/144 (82.64%), Query Frame = 2
Query:    8 SAGI*HKELRRTLQSLACGKVRVLQKLPKGRDVEDDDSFVFNEGFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLERDKNNPQIYNYLA 439
            + GI   ELRRTLQSLACGK RVL K PKG++VED D F+FN  F   L+RIK+N IQMKETVEE  STTERVFQDRQYQ+DAAIVRIMK RK L H LL++EL+ QLKFP+KP DLKKRIESLIDR+Y+ERDK+NP  Y+Y+A
Sbjct:  616 ATGIEDSELRRTLQSLACGKARVLIKSPKGKEVEDGDKFIFNGEFKHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA 759          
BLAST of EY756575 vs. ExPASy Swiss-Prot
Match: CUL4A_MOUSE (Cullin-4A OS=Mus musculus GN=Cul4a PE=2 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.450e-53
Identity = 102/144 (70.83%), Postives = 119/144 (82.64%), Query Frame = 2
Query:    8 SAGI*HKELRRTLQSLACGKVRVLQKLPKGRDVEDDDSFVFNEGFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLERDKNNPQIYNYLA 439
            + GI   ELRRTLQSLACGK RVL K PKG++VED D F+FN  F   L+RIK+N IQMKETVEE  STTERVFQDRQYQ+DAAIVRIMK RK L H LL++EL+ QLKFP+KP DLKKRIESLIDR+Y+ERDK++P  Y+Y+A
Sbjct:  616 ATGIEDSELRRTLQSLACGKARVLIKSPKGKEVEDGDKFIFNADFKHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYMERDKDSPNQYHYVA 759          
BLAST of EY756575 vs. ExPASy Swiss-Prot
Match: CUL4_DICDI (Cullin-4 OS=Dictyostelium discoideum GN=culD PE=3 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 3.359e-34
Identity = 71/116 (61.21%), Postives = 90/116 (77.59%), Query Frame = 2
Query:   92 KGRDVEDDDSFVFNEGFTAPLYRIKVNAIQMKETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLKFPIKPADLKKRIESLIDREYLERDKNNPQIYNYLA 439
            K + +++ D+F+FN  F++ L++IKVN+IQ++ETVEEN  T E +  DRQYQVDAAIVRIMKTRK L+H LLI+EL   LKF  KP DLKKRIE LI++EYL RD  N  IYNY+A
Sbjct:  687 KTKVIDETDTFLFNSKFSSKLFKIKVNSIQIQETVEENQKTNENIISDRQYQVDAAIVRIMKTRKTLAHNLLISELVSLLKFQPKPVDLKKRIEILIEKEYLCRDPENAMIYNYMA 802          
BLAST of EY756575 vs. ExPASy Swiss-Prot
Match: CUL3_SCHPO (Cullin-3 OS=Schizosaccharomyces pombe GN=cul3 PE=1 SV=2)

HSP 1 Score: 124.79 bits (312), Expect = 4.698e-28
Identity = 67/141 (47.52%), Postives = 92/141 (65.25%), Query Frame = 2
Query:   29 ELRRTLQSLACGKVRVLQKLPKGRDVEDDDSFVFNEGFTAPLYRIKVNAIQMK--ETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQL--KFPIKPADLKKRIESLIDREYLERDKNNPQIYNYLA 439
            +L+R LQSLAC K ++L K PKGR+V   D F FNE F + L RIK++ +     E   E   T E+V + R++Q DA IVR+MK RKV  H  L+ E+ +QL  +F   P  +K+RIE+LI+REYL+R  +N +IY YLA
Sbjct:  645 DLKRNLQSLACAKYKILLKDPKGREVNAGDKFYFNENFVSNLARIKISTVAQTRVEDDSERKRTLEKVDESRKHQADACIVRVMKDRKVCEHNQLMAEVTRQLNPRFHPSPMMIKRRIEALIEREYLQRQADNGRIYEYLA 785          
BLAST of EY756575 vs. ExPASy Swiss-Prot
Match: CUL3_XENTR (Cullin-3 OS=Xenopus tropicalis GN=cul3 PE=2 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 3.977e-27
Identity = 66/144 (45.83%), Postives = 95/144 (65.97%), Query Frame = 2
Query:   26 KELRRTLQSLACGKV--RVLQKLPKGRDVEDDDSFVFNEGFTAPLYRIKVNAIQMK--ETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLK--FPIKPADLKKRIESLIDREYLERDKNNPQIYNYLA 439
            +EL R LQSLACGK   RVL K PK +++E    F  N+ FT+ L+R+K+  +  K  E+  E   T ++V  DR+++++AAIVRIMK+RK + H +L+ E+ QQLK  F   P  +KKRIE LI+REYL R   + ++Y Y+A
Sbjct:  625 RELVRALQSLACGKPTQRVLTKEPKSKEIESGHMFTVNDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA 768          
BLAST of EY756575 vs. ExPASy Swiss-Prot
Match: CUL3_HUMAN (Cullin-3 OS=Homo sapiens GN=CUL3 PE=1 SV=2)

HSP 1 Score: 121.709 bits (304), Expect = 3.977e-27
Identity = 66/144 (45.83%), Postives = 96/144 (66.67%), Query Frame = 2
Query:   26 KELRRTLQSLACGKV--RVLQKLPKGRDVEDDDSFVFNEGFTAPLYRIKVNAIQMK--ETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLK--FPIKPADLKKRIESLIDREYLERDKNNPQIYNYLA 439
            +EL R LQSLACGK   RVL K PK +++E+   F  N+ FT+ L+R+K+  +  K  E+  E   T ++V  DR+++++AAIVRIMK+RK + H +L+ E+ QQLK  F   P  +KKRIE LI+REYL R   + ++Y Y+A
Sbjct:  625 RELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA 768          
BLAST of EY756575 vs. ExPASy Swiss-Prot
Match: CUL3B_XENLA (Cullin-3-B OS=Xenopus laevis GN=cul3b PE=1 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 3.977e-27
Identity = 66/144 (45.83%), Postives = 95/144 (65.97%), Query Frame = 2
Query:   26 KELRRTLQSLACGKV--RVLQKLPKGRDVEDDDSFVFNEGFTAPLYRIKVNAIQMK--ETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLK--FPIKPADLKKRIESLIDREYLERDKNNPQIYNYLA 439
            +EL R LQSLACGK   RVL K PK +++E    F  N+ FT+ L+R+K+  +  K  E+  E   T ++V  DR+++++AAIVRIMK+RK + H +L+ E+ QQLK  F   P  +KKRIE LI+REYL R   + ++Y Y+A
Sbjct:  625 RELVRALQSLACGKPTQRVLTKEPKSKEIESGHMFTVNDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA 768          
BLAST of EY756575 vs. ExPASy Swiss-Prot
Match: CUL3A_XENLA (Cullin-3-A OS=Xenopus laevis GN=cul3a PE=1 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 3.977e-27
Identity = 66/144 (45.83%), Postives = 95/144 (65.97%), Query Frame = 2
Query:   26 KELRRTLQSLACGKV--RVLQKLPKGRDVEDDDSFVFNEGFTAPLYRIKVNAIQMK--ETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLK--FPIKPADLKKRIESLIDREYLERDKNNPQIYNYLA 439
            +EL R LQSLACGK   RVL K PK +++E    F  N+ FT+ L+R+K+  +  K  E+  E   T ++V  DR+++++AAIVRIMK+RK + H +L+ E+ QQLK  F   P  +KKRIE LI+REYL R   + ++Y Y+A
Sbjct:  625 RELVRALQSLACGKPTQRVLTKEPKSKEIESGHMFTVNDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA 768          
BLAST of EY756575 vs. ExPASy Swiss-Prot
Match: CUL3_MOUSE (Cullin-3 OS=Mus musculus GN=Cul3 PE=1 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 5.195e-27
Identity = 66/144 (45.83%), Postives = 95/144 (65.97%), Query Frame = 2
Query:   26 KELRRTLQSLACGKV--RVLQKLPKGRDVEDDDSFVFNEGFTAPLYRIKVNAIQMK--ETVEENTSTTERVFQDRQYQVDAAIVRIMKTRKVLSHTLLITELFQQLK--FPIKPADLKKRIESLIDREYLERDKNNPQIYNYLA 439
            +EL R LQSLACGK   RVL K PK +++E    F  N+ FT+ L+R+K+  +  K  E+  E   T ++V  DR+++++AAIVRIMK+RK + H +L+ E+ QQLK  F   P  +KKRIE LI+REYL R   + ++Y Y+A
Sbjct:  625 RELVRALQSLACGKPTQRVLTKEPKSKEIESGHIFTVNDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA 768          
The following BLAST results are available for this feature:
BLAST of EY756575 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 26
Match NameE-valueIdentityDescription
CUL4B_HUMAN5.888e-5572.22Cullin-4B OS=Homo sapiens GN=CUL4B PE=1 SV=3[more]
CUL4A_HUMAN6.510e-5471.53Cullin-4A OS=Homo sapiens GN=CUL4A PE=1 SV=3[more]
CUL4A_MOUSE1.450e-5370.83Cullin-4A OS=Mus musculus GN=Cul4a PE=2 SV=1[more]
CUL4_DICDI3.359e-3461.21Cullin-4 OS=Dictyostelium discoideum GN=culD PE=3 ... [more]
CUL3_SCHPO4.698e-2847.52Cullin-3 OS=Schizosaccharomyces pombe GN=cul3 PE=1... [more]
CUL3_XENTR3.977e-2745.83Cullin-3 OS=Xenopus tropicalis GN=cul3 PE=2 SV=1[more]
CUL3_HUMAN3.977e-2745.83Cullin-3 OS=Homo sapiens GN=CUL3 PE=1 SV=2[more]
CUL3B_XENLA3.977e-2745.83Cullin-3-B OS=Xenopus laevis GN=cul3b PE=1 SV=1[more]
CUL3A_XENLA3.977e-2745.83Cullin-3-A OS=Xenopus laevis GN=cul3a PE=1 SV=1[more]
CUL3_MOUSE5.195e-2745.83Cullin-3 OS=Mus musculus GN=Cul3 PE=1 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-010-B08-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756575 ID=EY756575|Name=EY756575|organism=Citrus sinensis|type=EST|length=724bp
CCACGCGTCCGCTGGCATTTAACATAAGGAACTGAGGAGGACTCTACAGT
CTCTTGCTTGCGGTAAAGTACGCGTCCTGCAAAAGTTGCCAAAGGGAAGG
GATGTGGAGGATGATGATTCATTTGTGTTCAATGAAGGATTTACTGCTCC
CCTTTATCGTATTAAGGTAAATGCTATACAGATGAAGGAAACAGTGGAAG
AAAACACTAGCACCACTGAAAGAGTATTTCAGGACCGTCAATATCAGGTG
GATGCTGCCATTGTTCGGATAATGAAGACTAGAAAAGTGTTGAGTCACAC
ACTTCTAATAACCGAACTCTTCCAACAGCTGAAATTTCCTATAAAGCCGG
CCGATCTGAAGAAAAGGATTGAGAGCCTTATCGATAGGGAGTACCTGGAG
CGTGACAAGAACAATCCGCAGATATATAATTACCTGGCCTAGTCCCCCAT
TTTGTCACACACACAAATGTGATGTTTTTCTTTGCATGGCGGCGTAATCA
AATGTTATCTCTCCCCTGTACAGAAAGTTGTAGTTCCTTTTTTTTCCTTC
TTCTTCTTTGTTTTTTCGTTTTTTAACCCAACATTTGTAATTGTAAAGTA
TAATCGGCCTTTCTTTTGAGACCTTTCATCTCATTCTGGACTTGTGAGCT
TCTTGAAATAAATTACTTATTTTTTTCTTTCTTTTAATCATATGAGAAGC
TGCACCTTGCTGGTTGCTGCNGTT
back to top