EY756573

Overview
NameEY756573
Unique NameEY756573
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length780
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig11024 contig Csv1_Contig11024:541..1320. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756573 vs. ExPASy Swiss-Prot
Match: Y1341_ORYSJ (B3 domain-containing protein Os01g0234100 OS=Oryza sativa subsp. japonica GN=Os01g0234100 PE=2 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.668e-13
Identity = 34/119 (28.57%), Postives = 71/119 (59.66%), Query Frame = 1
Query:  268 NDTDALRACKF-TTSRDEFAMWDKTLKAFELLGMSVGFXXXXXXXXXXXXFESEGAEDTRRYIEAKAQQSQTQDEIRNIEARLVELKGAWQRFDAEISSLKSSAESYELKFREVANAPW 621
            N  + +RAC   T+S+++F +W KTL++F+LLGM+V F             +     +  +Y E K ++S+  ++++ +E+ ++ +K   ++ DAE+  ++SS  ++++  R++A APW
Sbjct:  377 NIAEGIRACGAGTSSQEDFLIWKKTLQSFDLLGMNVAFLLKRVDDILGLPEQPRDPSECSKYNELKLERSRAGEKVKALESMMLTVKDVLKKIDAEMEEMESSVRNHDIALRKIATAPW 495          

HSP 2 Score: 76.2554 bits (186), Expect = 2.179e-13
Identity = 38/85 (44.71%), Postives = 53/85 (62.35%), Query Frame = 1
Query:   13 PDIDTSVVLEDESGIQYTAKYFAEKTGLSAGWRQFSTAHNLVEGDVLVFQLIAPLKLKVYIIRANDFTEVDGALGLLNLDAPSKQ 267
            P  DT +VLEDE+G  +   Y   K GLSAGWR F+  H++  GDV+VF+L++  K KV+IIR  + +  D A GL +  A  K+
Sbjct:  179 PKHDTDIVLEDENGNNHNTNYLGGKQGLSAGWRGFAINHDIKVGDVVVFELVSTTKFKVHIIRDKNISPTDRAPGLKSFYACKKR 263          
BLAST of EY756573 vs. ExPASy Swiss-Prot
Match: Y6944_ORYSJ (B3 domain-containing protein Os06g0194400 OS=Oryza sativa subsp. japonica GN=Os06g0194400 PE=2 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 2.846e-13
Identity = 38/71 (53.52%), Postives = 45/71 (63.38%), Query Frame = 1
Query:   13 PDIDTSVVLEDESGIQYTAKYFAEKTGLSAGWRQFSTAHNLVEGDVLVFQLIAPLKLKVYIIRANDFTEVD 225
            P  D ++ L DE   ++   Y A K GLS GWR FS AH LV+GD LVFQLI   K KVYIIRA+ + E D
Sbjct:  166 PKRDETIRLVDEEDDEFDTLYLANKRGLSGGWRGFSIAHKLVDGDCLVFQLIQRTKFKVYIIRASSYYETD 236          
BLAST of EY756573 vs. ExPASy Swiss-Prot
Match: Y3918_ARATH (B3 domain-containing protein At3g19184 OS=Arabidopsis thaliana GN=At3g19184 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 7.009e-12
Identity = 41/89 (46.07%), Postives = 49/89 (55.06%), Query Frame = 1
Query:   13 PDIDTSVVLEDESGIQYTAKYFAEKTGLSAGWRQFSTAHNLVEGDVLVFQLIAPLKLKVYIIRANDFTEVDGALGLLNLDAPSKQNDTD 279
            P  D  + L DE   +  AKY A+K GLS GWR F+  H LV+GD +VF LIA    KVYIIR ND    D     +N D  S  N+ D
Sbjct:  157 PKRDVIMTLVDEEEEESQAKYLAQKNGLSGGWRGFAIDHQLVDGDAVVFHLIARTTFKVYIIRVNDDANNDSDGNEVN-DDDSDGNEED 244          
BLAST of EY756573 vs. ExPASy Swiss-Prot
Match: Y5814_ORYSJ (B3 domain-containing protein Os05g0481400 OS=Oryza sativa subsp. japonica GN=Os05g0481400 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 2.663e-11
Identity = 32/66 (48.48%), Postives = 44/66 (66.67%), Query Frame = 1
Query:   13 PDIDTSVVLEDESGIQYTAKYFAEKTGLSAGWRQFSTAHNLVEGDVLVFQLIAPLKLKVYIIRAND 210
            P  +  +VLEDE G ++ + Y   +TGLS GWR F+  HNL +GD LVF+L  P + K+YII+A D
Sbjct:  166 PPKEYKMVLEDEEGGEFDSVYIGNRTGLSGGWRGFAMHHNLEDGDSLVFELAEPDRFKIYIIKAVD 231          
BLAST of EY756573 vs. ExPASy Swiss-Prot
Match: Y5828_ARATH (Putative B3 domain-containing protein At5g58280 OS=Arabidopsis thaliana GN=At5g58280 PE=3 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 3.478e-11
Identity = 30/89 (33.71%), Postives = 49/89 (55.06%), Query Frame = 1
Query:   13 PDIDTSVVLEDESGIQYTAKYFAEKTGLSAGWRQFSTAHNLVEGDVLVFQLIAPLKLKVYIIRANDFTEVDGALGLLNLDAPSKQNDTD 279
            P+    + LEDE G  Y A Y   + GLS GW++F+  H L +GD L+F+L+ P K K+Y+ + N+   +  A        PS++ + +
Sbjct:  154 PEETMEIELEDEEGEVYEAVYIGRRAGLSGGWKRFALDHKLDDGDALLFELVEPKKFKIYVFKGNENANLTSARKRGRATTPSEEEEEE 242          
The following BLAST results are available for this feature:
BLAST of EY756573 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
Y1341_ORYSJ1.668e-1328.57B3 domain-containing protein Os01g0234100 OS=Oryza... [more]
Y6944_ORYSJ2.846e-1353.52B3 domain-containing protein Os06g0194400 OS=Oryza... [more]
Y3918_ARATH7.009e-1246.07B3 domain-containing protein At3g19184 OS=Arabidop... [more]
Y5814_ORYSJ2.663e-1148.48B3 domain-containing protein Os05g0481400 OS=Oryza... [more]
Y5828_ARATH3.478e-1133.71Putative B3 domain-containing protein At5g58280 OS... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-010-B06-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756573 ID=EY756573|Name=EY756573|organism=Citrus sinensis|type=EST|length=780bp
CCACGCGTCCGACCAGATATTGATACCTCTGTGGTTTTGGAAGATGAATC
TGGAATCCAGTACACGGCAAAATATTTTGCTGAAAAGACGGGATTGAGTG
CTGGTTGGAGACAATTTTCCACTGCACACAATTTGGTTGAGGGAGATGTT
TTGGTCTTTCAGTTAATTGCACCTCTAAAACTTAAGGTGTACATAATAAG
GGCCAATGATTTTACTGAGGTGGATGGGGCTCTTGGCCTTCTAAATTTGG
ATGCTCCTTCAAAGCAAAATGATACAGATGCCTTGAGAGCTTGCAAGTTT
ACTACATCCCGTGATGAATTTGCTATGTGGGACAAGACTCTGAAAGCCTT
TGAGCTTTTGGGCATGAGTGTCGGCTTCTTACGTGCTCGCCTACGCCGGC
TTCAGAGATTAGCTTTTGAATCAGAAGGTGCCGAGGACACAAGGAGGTAT
ATAGAAGCTAAAGCTCAACAATCTCAGACGCAAGATGAGATAAGAAATAT
TGAAGCAAGGCTCGTGGAATTGAAAGGTGCTTGGCAGAGGTTTGATGCAG
AAATCTCAAGTCTGAAGTCCTCAGCTGAGAGCTATGAGCTCAAGTTCCGA
GAAGTGGCAAACGCTCCATGGTGACGTTCTAGTTGTTATGTGCCTAATAA
TTTTTTGTTAAATTTTTTTTTTTAAATTACCGTTGGTCAATCCTTTTTTT
TCTTGTGTATCATCATTAATGACTCCTCTGTAACTTGAAATAGCAACGAG
GTGAACCTGTTTTCATGTGGGTAAAAANNN
back to top