EY756561

Overview
NameEY756561
Unique NameEY756561
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length651
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig11256 contig Csv1_Contig11256:339..989. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756561 vs. ExPASy Swiss-Prot
Match: CB24_ARATH (Chlorophyll a-b binding protein 4, chloroplastic OS=Arabidopsis thaliana GN=CAB4 PE=1 SV=1)

HSP 1 Score: 300.827 bits (769), Expect = 3.950e-81
Identity = 141/154 (91.56%), Postives = 146/154 (94.81%), Query Frame = 3
Query:   12 VNSRWAMLGVVGMLLPEVFTKIGIINAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPPNEVGYPGGIFNPLNFAPTDEAKEKELANGRLAMLAFLGFIVQHNVTGKGPFENLLQHISDPWHNTIVQTLS 473
            VN RWAMLGV GMLLPEVFTKIGIIN P+WYDAGK +YFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLP  EVGYPGGIFNPLNFAPT EAKEKELANGRLAMLAFLGF+VQHNVTGKGPFENLLQH+SDPWHNTIVQT +
Sbjct:   98 VNGRWAMLGVAGMLLPEVFTKIGIINVPEWYDAGKEQYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPKGEVGYPGGIFNPLNFAPTQEAKEKELANGRLAMLAFLGFVVQHNVTGKGPFENLLQHLSDPWHNTIVQTFN 251          
BLAST of EY756561 vs. ExPASy Swiss-Prot
Match: CB24_PEA (Chlorophyll a-b binding protein P4, chloroplastic OS=Pisum sativum GN=lhcA-P4 PE=1 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 7.450e-80
Identity = 141/156 (90.38%), Postives = 145/156 (92.95%), Query Frame = 3
Query:   12 VNSRWAMLGVVGMLLPEVFTKIGIINAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPPNEVGYPGGIFNPLNFAPTDEAKEKELANGRLAMLAFLGFIVQHNVTGKGPFENLLQHISDPWHNTIVQTLSGN 479
            VN RWAMLGV GMLLPEVFT IGIIN P+WY AGK EYFASSSTLFVIEFIL HYVEIRRWQDIKNPGSVNQDPIFKQYSLP  EVGYPGGIFNPLNFAPT EAKEKE+ANGRLAMLAFLGFI+QHNVTGKGPF+NLLQHISDPWHNTIVQTL GN
Sbjct:   97 VNGRWAMLGVAGMLLPEVFTSIGIINVPKWYAAGKEEYFASSSTLFVIEFILSHYVEIRRWQDIKNPGSVNQDPIFKQYSLPAGEVGYPGGIFNPLNFAPTLEAKEKEIANGRLAMLAFLGFIIQHNVTGKGPFDNLLQHISDPWHNTIVQTLGGN 252          
BLAST of EY756561 vs. ExPASy Swiss-Prot
Match: CB120_HORVU (Chlorophyll a-b binding protein 1B-20, chloroplastic (Fragment) OS=Hordeum vulgare GN=LHC Ib-20 PE=1 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 1.411e-62
Identity = 117/156 (75.00%), Postives = 130/156 (83.33%), Query Frame = 3
Query:   12 VNSRWAMLGVVGMLLPEVFTKIGIINAPQWYDA-GKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPPNEVGYPGGIFNPLNFAPTDEAKEKELANGRLAMLAFLGFIVQHNVTGKGPFENLLQHISDPWHNTIVQTLSG 476
            VN RWAMLGV GML+PEV TK G++NAP+W    GK  YFASSST   +  +   YVEIRRWQDIKNPGSVNQDPIFK YSLPP+E GYPG +FNPLNFAP  E KEKELANGRLAMLAFLGF+VQHNV GKGPFENL QH++DPWHNTI+QT+SG
Sbjct:   77 VNGRWAMLGVAGMLIPEVLTKAGLMNAPEWLRLPGKETYFASSSTALRVH-MSSTYVEIRRWQDIKNPGSVNQDPIFKSYSLPPHECGYPGRVFNPLNFAPL-ENKEKELANGRLAMLAFLGFLVQHNVHGKGPFENLQQHLADPWHNTIIQTISG 230          
BLAST of EY756561 vs. ExPASy Swiss-Prot
Match: CB12_PETHY (Chlorophyll a-b binding protein, chloroplastic OS=Petunia hybrida PE=2 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 5.219e-41
Identity = 83/160 (51.88%), Postives = 103/160 (64.38%), Query Frame = 3
Query:   12 VNSRWAMLGVVGMLLPEVFTKIGIINAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPPNEVGYPGGI-FNPLNF-----APTDEAKEKELANGRLAMLAFLGFIVQHNVTGKGPFENLLQHISDPWHNTIVQTLS 473
            V+SRWAMLG  G+ +PE  TKIG++N P WY AG+ EYF  ++TLFVIE +L  + E RRW DI  PG VN DPIF    L   +VGYPGG+ F+PL +     A   E + KE+ NGRLAMLA +G   QH  TG GP +NL  H++DP H TI    S
Sbjct:  109 VHSRWAMLGAAGIFIPEFLTKIGVLNTPSWYTAGEQEYFTDTTTLFVIELVLIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPAKIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFAAFS 268          
BLAST of EY756561 vs. ExPASy Swiss-Prot
Match: CB12_SOLLC (Chlorophyll a-b binding protein 7, chloroplastic OS=Solanum lycopersicum GN=CAB7 PE=3 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 1.519e-40
Identity = 81/160 (50.62%), Postives = 103/160 (64.38%), Query Frame = 3
Query:   12 VNSRWAMLGVVGMLLPEVFTKIGIINAPQWYDAGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPPNEVGYPGGI-FNPLNF-----APTDEAKEKELANGRLAMLAFLGFIVQHNVTGKGPFENLLQHISDPWHNTIVQTLS 473
            V+ RWAMLG  G+ +PE+ TKIGI+N P WY AG+ EYF  ++TLF++E +L  + E RRW DI  PG VN DPIF    L   +VGYPGG+ F+PL +     A   E + KE+ NGRLAMLA +G   QH  TG GP +NL  H++DP H TI    S
Sbjct:  109 VHCRWAMLGAAGIFIPELLTKIGILNTPSWYTAGEQEYFTDTTTLFIVELVLIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGYPGGLWFDPLGWGSGSPAKIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFAAFS 268          
BLAST of EY756561 vs. ExPASy Swiss-Prot
Match: CB23_PEA (Chlorophyll a-b binding protein 3, chloroplastic OS=Pisum sativum GN=lhca3 PE=1 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 5.602e-27
Identity = 74/174 (42.53%), Postives = 98/174 (56.32%), Query Frame = 3
Query:   12 VNSRWAMLGVVGMLLPEVFTKIGII---NAPQWYD------AGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLP-------PNEVGYPGG-IFNPLNFAPTD----EAKEKELANGRLAMLAFLGFIVQHNVTGKGPFENLLQHISDPWHNTIVQTL 470
            +N R+AMLG VG + PE   K+G+I    A  W+       AG   Y+A + TLFV+E  L  + E RR+QD   PGS+      KQY L             YPGG  FNPL F   +    E K KE+ NGRLAMLA LG+ +Q  VTG GP++NLL H++DP +N ++ +L
Sbjct:  104 INGRFAMLGAVGAIAPEYLGKVGLIPQETALAWFQTGVIPPAGTYNYWADNYTLFVLEMALMGFAEHRRFQDWAKPGSMG-----KQYFLGLEKGFGGSGNPAYPGGPFFNPLGFGKDEKSLKELKLKEVKNGRLAMLAILGYFIQGLVTGVGPYQNLLDHVADPVNNNVLTSL 272          
BLAST of EY756561 vs. ExPASy Swiss-Prot
Match: CB13_SOLLC (Chlorophyll a-b binding protein 8, chloroplastic OS=Solanum lycopersicum GN=CAB8 PE=3 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 5.602e-27
Identity = 73/174 (41.95%), Postives = 99/174 (56.90%), Query Frame = 3
Query:   12 VNSRWAMLGVVGMLLPEVFTKIGII---NAPQWYD------AGKAEYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLP-------PNEVGYPGG-IFNPLNFAPTD----EAKEKELANGRLAMLAFLGFIVQHNVTGKGPFENLLQHISDPWHNTIVQTL 470
            +N R+AMLG  G + PE+  K G+I    A  W+       AG   Y+A + TLFV+E  L  + E RR+QD   PGS+      KQY L          +  YPGG +FNPL F   +    E K KE+ NGRLAMLA LG+ +Q  VTG GP++NLL H++DP +N ++ +L
Sbjct:  102 INGRFAMLGAAGAIAPEILGKAGLIPQETALAWFQTGVIPPAGTYNYWADNYTLFVLEMALMGFAEHRRFQDWAKPGSMG-----KQYFLGLEKGLGGSGDPAYPGGPLFNPLGFGKDEKSMKELKLKEIKNGRLAMLAILGYFIQALVTGVGPYQNLLDHLADPVNNNVLTSL 270          
BLAST of EY756561 vs. ExPASy Swiss-Prot
Match: CB121_HORVU (Chlorophyll a-b binding protein 1B-21, chloroplastic OS=Hordeum vulgare GN=LHC Ib-21 PE=1 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 5.079e-20
Identity = 63/159 (39.62%), Postives = 84/159 (52.83%), Query Frame = 3
Query:   21 RWAMLGVVGMLLPEVFTKIGIINAPQW--YDAGKAEYFASS------STLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPPNEVGYPGGIFNPLNF----APTDEAKEKELANGRLAMLAFLGFIVQHNV-TGKGPFENLLQHISDPWHNTI 458
            RWAML V G+L+PE       + A +W     G+A Y  +        T+  IEF+   + E +R        ++ +DP  K+Y         PGG F+PL F    A  +E K KE+ NGRLAMLAF+GF VQ +   G GP ENL  H++DPWHN I
Sbjct:   92 RWAMLCVPGVLVPEALGLGNWVKAQEWAALPDGQATYLGNPVPWGNLPTILAIEFLAIAFAEQQR--------TMEKDPEKKKY---------PGGAFDPLGFSKDPAKFEELKLKEIKNGRLAMLAFVGFCVQQSAYPGTGPLENLATHLADPWHNNI 233          
BLAST of EY756561 vs. ExPASy Swiss-Prot
Match: CB11_SOLLC (Chlorophyll a-b binding protein 6A, chloroplastic OS=Solanum lycopersicum GN=CAB6A PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 2.521e-19
Identity = 60/162 (37.04%), Postives = 86/162 (53.09%), Query Frame = 3
Query:   12 VNSRWAMLGVVGMLLPEVFTKIGIINAPQW--YDAGKAEY------FASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKQYSLPPNEVGYPGGIFNPLNF----APTDEAKEKELANGRLAMLAFLGFIVQHNV-TGKGPFENLLQHISDPWHNTI 458
            ++ RWAML V G+++PE       + A +W     G+A Y      + +  T+  IEF+   +VE +R        S+ +D   K+Y         PGG F+PL +    A  +E K KE+ NGRLA+LA +GF VQ +   G GP ENL  H++DPWHN I
Sbjct:   90 IHCRWAMLAVPGIIVPEALGLGNWVKAQEWAAIPGGQATYLGQPVPWGTLPTILAIEFLAIAFVEHQR--------SMEKDSEKKKY---------PGGAFDPLGYSKDPAKFEELKVKEIKNGRLALLAIVGFCVQQSAYLGTGPLENLATHLADPWHNNI 234          
BLAST of EY756561 vs. ExPASy Swiss-Prot
Match: CB26_ARATH (Chlorophyll a-b binding protein CP26, chloroplastic OS=Arabidopsis thaliana GN=LHCB5 PE=2 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 1.806e-17
Identity = 57/170 (33.53%), Postives = 86/170 (50.59%), Query Frame = 3
Query:   12 VNSRWAMLGVVGMLLPEVFTKIGIINAPQ--WY-------DAGKAEYFASSSTLFVIEFILFHYVEI--RRWQDIKNPGSVNQDPIFKQYSLPPNEVGYPGGIFNPLNFAPTDEA----KEKELANGRLAMLAFLGFIVQHNVTGKGPFENLLQHISDPWHNTIVQTLSG 476
            +++RWAMLG  G ++PE   K G    P+  W+       D     YF  +  + ++  ++   V +    +  I N G   +D +            +PGG F+PL  A   E     K KE+ NGRLAM A LGF +Q  VTG+GP ENL +H+SDP+ N ++  ++G
Sbjct:  116 IHARWAMLGAAGFIIPEALNKYGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLVLAVVAEVVLLGGAEYYRITN-GLDFEDKL------------HPGGPFDPLGLAKDPEQGALLKVKEIKNGRLAMFAMLGFFIQAYVTGEGPVENLAKHLSDPFGNNLLTVIAG 272          
The following BLAST results are available for this feature:
BLAST of EY756561 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 75
Match NameE-valueIdentityDescription
CB24_ARATH3.950e-8191.56Chlorophyll a-b binding protein 4, chloroplastic O... [more]
CB24_PEA7.450e-8090.38Chlorophyll a-b binding protein P4, chloroplastic ... [more]
CB120_HORVU1.411e-6275.00Chlorophyll a-b binding protein 1B-20, chloroplast... [more]
CB12_PETHY5.219e-4151.88Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB12_SOLLC1.519e-4050.63Chlorophyll a-b binding protein 7, chloroplastic O... [more]
CB23_PEA5.602e-2742.53Chlorophyll a-b binding protein 3, chloroplastic O... [more]
CB13_SOLLC5.602e-2741.95Chlorophyll a-b binding protein 8, chloroplastic O... [more]
CB121_HORVU5.079e-2039.62Chlorophyll a-b binding protein 1B-21, chloroplast... [more]
CB11_SOLLC2.521e-1937.04Chlorophyll a-b binding protein 6A, chloroplastic ... [more]
CB26_ARATH1.806e-1733.53Chlorophyll a-b binding protein CP26, chloroplasti... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-010-A05-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756561 ID=EY756561|Name=EY756561|organism=Citrus sinensis|type=EST|length=651bp
CCACGCGTCCGGTGAATTCGCGCTGGGCCATGTTGGGGGTTGTTGGAATG
TTGTTGCCCGAAGTTTTCACAAAGATTGGAATTATTAATGCTCCTCAATG
GTATGATGCTGGGAAGGCTGAGTACTTTGCATCATCATCGACCCTTTTCG
TGATCGAGTTCATCTTGTTCCACTATGTGGAGATAAGAAGATGGCAAGAC
ATAAAGAACCCAGGAAGTGTCAACCAAGACCCCATTTTCAAGCAGTACAG
CTTGCCTCCAAACGAAGTTGGGTACCCCGGTGGCATCTTCAACCCACTCA
ACTTTGCACCCACTGACGAGGCAAAGGAGAAGGAGCTTGCCAATGGGAGA
TTGGCAATGTTGGCATTCTTGGGATTTATTGTTCAGCACAATGTGACAGG
CAAAGGGCCATTTGAAAACCTCCTGCAACACATCTCTGACCCATGGCACA
ACACCATCGTCCAGACACTAAGTGGTAATTAATCAAAGATGGATTGGCCA
TCCCGGATCCTGTTTCTTTCTTTTGTAACCATGAATCTGTAGTTTTTGAG
TGAGATTTGAGCATCAATGTAAACATGGAAACTCTCAATGTACAGGGGAA
CTATGATGGTATTTATATTATCATTTTACACCAAAAAAAAAAAAAAAAAA
A
back to top