EY756559

Overview
NameEY756559
Unique NameEY756559
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length509
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1721 contig Csv1_Contig1721:313..823. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756559 vs. ExPASy Swiss-Prot
Match: FER2_ARATH (Ferredoxin-2, chloroplastic OS=Arabidopsis thaliana GN=FD2 PE=1 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 5.582e-27
Identity = 53/63 (84.13%), Postives = 62/63 (98.41%), Query Frame = 2
Query:   35 LDLPYSCRAGACSSCTGKVLSGTVDQSEQSFLDDDQMGEGFVLTCAAYPTSDVTIETHKEEEL 223
            +DLPYSCRAG+CSSC GKV+SG+VDQS+QSFLDD+Q+GEGFVLTCAAYPTSDVTIETHKEE++
Sbjct:   85 IDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDEQIGEGFVLTCAAYPTSDVTIETHKEEDI 147          
BLAST of EY756559 vs. ExPASy Swiss-Prot
Match: FER_BRANA (Ferredoxin OS=Brassica napus PE=1 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 1.244e-26
Identity = 54/63 (85.71%), Postives = 60/63 (95.24%), Query Frame = 2
Query:   35 LDLPYSCRAGACSSCTGKVLSGTVDQSEQSFLDDDQMGEGFVLTCAAYPTSDVTIETHKEEEL 223
            +DLPYSCRAG+CSSC GKV+SG VDQS++SFLDDDQ+ EGFVLTCAAYPTSDVTIETHKEEEL
Sbjct:   33 IDLPYSCRAGSCSSCAGKVVSGFVDQSDESFLDDDQIAEGFVLTCAAYPTSDVTIETHKEEEL 95          
BLAST of EY756559 vs. ExPASy Swiss-Prot
Match: FER3_RAPSA (Ferredoxin, leaf L-A OS=Raphanus sativus PE=1 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 2.121e-26
Identity = 52/63 (82.54%), Postives = 61/63 (96.83%), Query Frame = 2
Query:   35 LDLPYSCRAGACSSCTGKVLSGTVDQSEQSFLDDDQMGEGFVLTCAAYPTSDVTIETHKEEEL 223
            +DLPYSCRAG+CSSC GKV+SG+VDQS+QSFLDDDQ+ EGFVLTCAAYPTSDVTIETH+EE++
Sbjct:   33 IDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDDQIAEGFVLTCAAYPTSDVTIETHREEDM 95          
BLAST of EY756559 vs. ExPASy Swiss-Prot
Match: FER1_SYNP6 (Ferredoxin-1 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=petF1 PE=1 SV=2)

HSP 1 Score: 117.857 bits (294), Expect = 2.770e-26
Identity = 53/63 (84.13%), Postives = 59/63 (93.65%), Query Frame = 2
Query:   35 LDLPYSCRAGACSSCTGKVLSGTVDQSEQSFLDDDQMGEGFVLTCAAYPTSDVTIETHKEEEL 223
            +DLPYSCRAGACS+C GKV+SGTVDQS+QSFLDDDQ+  GFVLTC AYPTSDVTIETHKEE+L
Sbjct:   36 IDLPYSCRAGACSTCAGKVVSGTVDQSDQSFLDDDQIAAGFVLTCVAYPTSDVTIETHKEEDL 98          
BLAST of EY756559 vs. ExPASy Swiss-Prot
Match: FER1_SYNE7 (Ferredoxin-1 OS=Synechococcus elongatus (strain PCC 7942) GN=petF PE=3 SV=2)

HSP 1 Score: 117.857 bits (294), Expect = 2.770e-26
Identity = 53/63 (84.13%), Postives = 59/63 (93.65%), Query Frame = 2
Query:   35 LDLPYSCRAGACSSCTGKVLSGTVDQSEQSFLDDDQMGEGFVLTCAAYPTSDVTIETHKEEEL 223
            +DLPYSCRAGACS+C GKV+SGTVDQS+QSFLDDDQ+  GFVLTC AYPTSDVTIETHKEE+L
Sbjct:   36 IDLPYSCRAGACSTCAGKVVSGTVDQSDQSFLDDDQIAAGFVLTCVAYPTSDVTIETHKEEDL 98          
BLAST of EY756559 vs. ExPASy Swiss-Prot
Match: FER_GLEJA (Ferredoxin OS=Gleichenia japonica PE=1 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 4.726e-26
Identity = 54/69 (78.26%), Postives = 58/69 (84.06%), Query Frame = 2
Query:   17 SG*RIALDLPYSCRAGACSSCTGKVLSGTVDQSEQSFLDDDQMGEGFVLTCAAYPTSDVTIETHKEEEL 223
            +G    LDLPYSCRAGACSSCTGK+L G VDQSEQSFLDDDQM EGFVLTC AYP  D+TIETH EE+L
Sbjct:   27 AGEEAGLDLPYSCRAGACSSCTGKLLDGRVDQSEQSFLDDDQMAEGFVLTCVAYPAGDITIETHAEEKL 95          
BLAST of EY756559 vs. ExPASy Swiss-Prot
Match: FER_DATME (Ferredoxin OS=Datura metel PE=1 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 1.796e-25
Identity = 52/64 (81.25%), Postives = 57/64 (89.06%), Query Frame = 2
Query:   38 DLPYSCRAGACSSCTGKVLSGTVDQSEQSFLDDDQMGEGFVLTCAAYPTSDVTIETHKEEELAG 229
            DLPYSCRAG+CSSC GKV +GTVDQS+ ++LDDDQM EGFVLTC AYP SDVTIETHKEEEL G
Sbjct:   34 DLPYSCRAGSCSSCAGKVTAGTVDQSDGNYLDDDQMAEGFVLTCVAYPQSDVTIETHKEEELTG 97          
BLAST of EY756559 vs. ExPASy Swiss-Prot
Match: FER_DATIN (Ferredoxin OS=Datura inoxia PE=1 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 1.796e-25
Identity = 52/64 (81.25%), Postives = 57/64 (89.06%), Query Frame = 2
Query:   38 DLPYSCRAGACSSCTGKVLSGTVDQSEQSFLDDDQMGEGFVLTCAAYPTSDVTIETHKEEELAG 229
            DLPYSCRAG+CSSC GKV +GTVDQS+ ++LDDDQM EGFVLTC AYP SDVTIETHKEEEL G
Sbjct:   34 DLPYSCRAGSCSSCAGKVTAGTVDQSDGNYLDDDQMAEGFVLTCVAYPQSDVTIETHKEEELTG 97          
BLAST of EY756559 vs. ExPASy Swiss-Prot
Match: FER_CHLFR (Ferredoxin OS=Chlorogloeopsis fritschii PE=1 SV=2)

HSP 1 Score: 114.39 bits (285), Expect = 3.063e-25
Identity = 52/63 (82.54%), Postives = 57/63 (90.48%), Query Frame = 2
Query:   35 LDLPYSCRAGACSSCTGKVLSGTVDQSEQSFLDDDQMGEGFVLTCAAYPTSDVTIETHKEEEL 223
            LDLPYSCRAGACS+C GK+ SGTVDQS+QSFLDDDQ+  G+VLTC AYPTSD TIETHKEEEL
Sbjct:   36 LDLPYSCRAGACSTCAGKIKSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKEEEL 98          
BLAST of EY756559 vs. ExPASy Swiss-Prot
Match: FER_DATST (Ferredoxin OS=Datura stramonium PE=1 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 4.000e-25
Identity = 51/64 (79.69%), Postives = 57/64 (89.06%), Query Frame = 2
Query:   38 DLPYSCRAGACSSCTGKVLSGTVDQSEQSFLDDDQMGEGFVLTCAAYPTSDVTIETHKEEELAG 229
            DLPYSCRAG+CSSC GKV +GTVDQS+ ++LDDDQM +GFVLTC AYP SDVTIETHKEEEL G
Sbjct:   34 DLPYSCRAGSCSSCAGKVTAGTVDQSDGNYLDDDQMADGFVLTCVAYPQSDVTIETHKEEELTG 97          
The following BLAST results are available for this feature:
BLAST of EY756559 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 109
Match NameE-valueIdentityDescription
FER2_ARATH5.582e-2784.13Ferredoxin-2, chloroplastic OS=Arabidopsis thalian... [more]
FER_BRANA1.244e-2685.71Ferredoxin OS=Brassica napus PE=1 SV=1[more]
FER3_RAPSA2.121e-2682.54Ferredoxin, leaf L-A OS=Raphanus sativus PE=1 SV=1[more]
FER1_SYNP62.770e-2684.13Ferredoxin-1 OS=Synechococcus sp. (strain ATCC 271... [more]
FER1_SYNE72.770e-2684.13Ferredoxin-1 OS=Synechococcus elongatus (strain PC... [more]
FER_GLEJA4.726e-2678.26Ferredoxin OS=Gleichenia japonica PE=1 SV=1[more]
FER_DATME1.796e-2581.25Ferredoxin OS=Datura metel PE=1 SV=1[more]
FER_DATIN1.796e-2581.25Ferredoxin OS=Datura inoxia PE=1 SV=1[more]
FER_CHLFR3.063e-2582.54Ferredoxin OS=Chlorogloeopsis fritschii PE=1 SV=2[more]
FER_DATST4.000e-2579.69Ferredoxin OS=Datura stramonium PE=1 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-010-A03-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756559 ID=EY756559|Name=EY756559|organism=Citrus sinensis|type=EST|length=509bp
TTCGTCGACCCACGCGTCCGGCTGAAGAATTGCGCTTGATCTTCCGTACT
CATGCAGGGCTGGGGCTTGCTCTTCCTGTACTGGGAAAGTCCTGTCTGGA
ACCGTTGACCAGTCGGAGCAAAGCTTTCTGGATGATGATCAAATGGGAGA
AGGTTTTGTTCTCACTTGTGCTGCTTATCCAACAAGTGATGTTACTATAG
AGACTCACAAGGAAGAGGAGCTCGCTGGTTAATAATGTGCTCTTGATATC
TCATTATTATCTTCTCTTTTATGTGTTGTGTTTTGTCTGATTATTTTAAT
GCTTTGAAAGGGATATTGAGTAATTTGAGAATGATTCTTGTAATGTGTTT
TTATTTCTTGTTGCAAAGAAGTTGTAATTGCACCGGCCATGAATGCGCAT
CGTACCTAGAGGGTGAGGTTTCTCATCCCATCCGAACATGGTACCGTTCT
ATAATTAAGAGTCAAGCAAGAACAATGGATCTTTCGTTGTATTTCAAAAA
AAAAAAAAA
back to top