EY756557

Overview
NameEY756557
Unique NameEY756557
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length910
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY756557 vs. ExPASy Swiss-Prot
Match: MOB1_ARATH (Mps one binder kinase activator-like 1 OS=Arabidopsis thaliana GN=At4g19045 PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.357e-15
Identity = 35/49 (71.43%), Postives = 41/49 (83.67%), Query Frame = 3
Query:   45 MSLFGLGRNQRTFLFTQSAPSGSKGAQIIIHIDATLGSGVLREAVRPAP 191
            MSLFGLGRNQ+TF   +SAPSG+KGA++  HIDATLGSG LREAV+  P
Sbjct:    1 MSLFGLGRNQKTFRPKKSAPSGTKGAELRKHIDATLGSGNLREAVKLPP 49          

HSP 2 Score: 35.039 bits (79), Expect = 1.357e-15
Identity = 16/25 (64.00%), Postives = 18/25 (72.00%), Query Frame = 1
Query:  184 LPPGEDLNEGLDGNTGDIINLINLV 258
            LPPGEDLNE L  NT D  N +NL+
Sbjct:   47 LPPGEDLNEWLAVNTVDFFNQVNLL 71          
The following BLAST results are available for this feature:
BLAST of EY756557 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
MOB1_ARATH1.357e-1571.43Mps one binder kinase activator-like 1 OS=Arabidop... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-010-A01-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756557 ID=EY756557|Name=EY756557|organism=Citrus sinensis|type=EST|length=910bp
TCTCCTCGACCACGCGTCCGCGGTCACTCTTCCCTTCTTCAGCCATGAGT
CTCTTCGGCCTCGGAAGAAATCAGAGAACATTTCTCTTCACACAGAGTGC
ACCCTCGGGGAGTAAGGGTGCACAAATTATAATACACATTGATGCCACCC
TTGGTAGTGGAGTCCTGAGGGAAGCAGTAAGACCTGCCCCCTGGAGAGGA
TCTCAATGAGGGGCTTGATGGTAATACTGGGGACATCATCAACCTGATAA
ATCTGGTTCTCTAGTACCCTCACCGAAACGCGCACCGCATGAAAGCTGCA
CCACAACGTCCGAAGGTCTTACTTATCGATTTAGATCGGGCAATTGGCGT
GCGAGGGGCGGAGACGATAGGAAGTTGCTGCTCCCGAAATAGCATCAAAA
ACCGCGATGGACGGGGACTCACTCATAGCAGGGAGATGGGGGGCGGATCC
GCGGCAAAAAAATGAACGCGCAACATCGAGCGACTAGAAGGAGGGCGGAA
GGCCCGGGCGCAGAAAGAAAAGCCGGGGTTGCCACCCACCTCACGTGCGC
GGTTATAGCAATACGCTAACCTGACGAAGGAAAGGAGCGAAAACACACCC
ACCAGCACTGACCAGCTACCGCCGCCGCCAATTTTCACTCACATAACCCC
AGGAGGGGGGGTGAGGGCGGGGGGGGATGAGTATACAATCAACAACATAC
TAAAAACGAGAGGGTGAAAAAGAAGAAACCGCGTTGAGCGCCCTCCGTCG
TGCTATGGAGGTGGTTGCAGGGTGAGGGGGATGGGTGGGTGTTGGGCGGC
CGTGAGCCAGTTTAAATTAATATATTTGCATCGCTACCAAGTGTAGTGCC
CTTTTGAGATTGTTCGATGGAAGGTGAGCGGGATGCTAGCCGCCCCCATG
GTTGGAGAGA
back to top