EY756556

Overview
NameEY756556
Unique NameEY756556
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length937
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13335 contig Csv1_Contig13335:1..938. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756556 vs. ExPASy Swiss-Prot
Match: PME3_CITSI (Pectinesterase 3 OS=Citrus sinensis PE=1 SV=1)

HSP 1 Score: 496.893 bits (1278), Expect = 6.895e-140
Identity = 255/289 (88.24%), Postives = 262/289 (90.66%), Query Frame = 1
Query:   49 MRAAMTNQGTCLDGFSHDDANKHVRDALSDGQVHVEKMCSNALAMIKNMTDTDMMIMRTSNNRKLIEETSTVDGWPAWLSTGDRRLLQSSSVTPNVVVAADGSGNFKTXXXXXXXXPQGGTKRYIIRIKAGVYRENVEVTKKHKNIMFIGDGRTRTIITGSRNVVDGSTTFKSATVAVVGEGFLARDITFQNTAGPSKHQAVALRVGADLSAFYNCDMLAYQDTLYVHSDRQFFVNCLIAGTVGFIFGNAAAVLQNVTSMHESQFPPKNGH-----SQGKADPNQTPAL 900
            M AAMTNQGTCLDGFSHDDANKHVRDALSDGQVHVEKMCSNALAMIKNMTDTDMMIMRTSNNRKLIEETSTVDGWPAWLSTGDRRLLQSSSVTPNVVVAADGSGNFKT        PQGGTKRYIIRIKAGVYRENVEVTKKHKNIMFIGDGRTRTIITGSRNVVDGSTTFKSATVAVVGEGFLARDITFQNTAGPSKHQAVALRVGADLSAFYNCDMLAYQDTLYVHS+RQFFVNCLIAGTV FIFGNAAAVLQN   +H  +  P +G      +QG+ADPNQ   +
Sbjct:  179 MSAAMTNQGTCLDGFSHDDANKHVRDALSDGQVHVEKMCSNALAMIKNMTDTDMMIMRTSNNRKLIEETSTVDGWPAWLSTGDRRLLQSSSVTPNVVVAADGSGNFKTVAASVAAAPQGGTKRYIIRIKAGVYRENVEVTKKHKNIMFIGDGRTRTIITGSRNVVDGSTTFKSATVAVVGEGFLARDITFQNTAGPSKHQAVALRVGADLSAFYNCDMLAYQDTLYVHSNRQFFVNCLIAGTVDFIFGNAAAVLQN-CDIHARK--PNSGQKNMVTAQGRADPNQNTGI 464          
BLAST of EY756556 vs. ExPASy Swiss-Prot
Match: PME1_CITSI (Pectinesterase 1 OS=Citrus sinensis GN=PECS-1.1 PE=2 SV=1)

HSP 1 Score: 488.034 bits (1255), Expect = 3.203e-137
Identity = 250/289 (86.51%), Postives = 257/289 (88.93%), Query Frame = 1
Query:   49 MRAAMTNQGTCLDGFSHDDANKHVRDALSDGQVHVEKMCSNALAMIKNMTDTDMMIMRTSNNRKLIEETSTVDGWPAWLSTGDRRLLQSSSVTPNVVVAADGSGNFKTXXXXXXXXPQGGTKRYIIRIKAGVYRENVEVTKKHKNIMFIGDGRTRTIITGSRNVVDGSTTFKSATVAVVGEGFLARDITFQNTAGPSKHQAVALRVGADLSAFYNCDMLAYQDTLYVHSDRQFFVNCLIAGTVGFIFGNAAAVLQNVTSMHESQFPPKNGH-----SQGKADPNQTPAL 900
            M AAMTNQGTCLDGFSHDDANKHVRDALSDGQVHVEKMCSNALAMIKNMTDTDMMIMRTSNNRKL EETSTVDGWPAWLS GDRRLLQSSSVTPN VVAADGSGNFKT        PQGGTKRYIIRIKAGVYRENVEVTKKHKNIMFIGDGRTRTIITGSRNVVDGSTTFKSAT AVVGEGFLARDITFQNTAGPSKHQAVALRVGADLSAFYNCDMLAYQDTLYVHS+RQFFVNCLIAGTV FIFGNAAAVLQN   +H  +  P +G      +QG+ DPNQ   +
Sbjct:  179 MSAAMTNQGTCLDGFSHDDANKHVRDALSDGQVHVEKMCSNALAMIKNMTDTDMMIMRTSNNRKLTEETSTVDGWPAWLSPGDRRLLQSSSVTPNAVVAADGSGNFKTVAAAVAAAPQGGTKRYIIRIKAGVYRENVEVTKKHKNIMFIGDGRTRTIITGSRNVVDGSTTFKSATAAVVGEGFLARDITFQNTAGPSKHQAVALRVGADLSAFYNCDMLAYQDTLYVHSNRQFFVNCLIAGTVDFIFGNAAAVLQN-CDIHARK--PNSGQKNMVTAQGRTDPNQNTGI 464          
BLAST of EY756556 vs. ExPASy Swiss-Prot
Match: PME3_ARATH (Pectinesterase/pectinesterase inhibitor 3 OS=Arabidopsis thaliana GN=PME3 PE=2 SV=2)

HSP 1 Score: 384.03 bits (985), Expect = 6.514e-106
Identity = 208/306 (67.97%), Postives = 226/306 (73.86%), Query Frame = 1
Query:   55 AAMTNQGTCLDGFSHDDANKHVRDALSDGQVHVEKMCSNALAMIKNMTDTDMMIMR-----TSNNRKLIEE----TSTVD----------GWPAWLSTGDRRLLQSSSVTPNVVVAADGSGNFKTXXXXXXXXPQGGTKRYIIRIKAGVYRENVEVTKKHKNIMFIGDGRTRTIITGSRNVVDGSTTFKSATVAVVGEGFLARDITFQNTAGPSKHQAVALRVGADLSAFYNCDMLAYQDTLYVHSDRQFFVNCLIAGTVGFIFGNAAAVLQNVTSMHESQFPPKNGH-----SQGKADPNQTPAL 900
            +A+TNQ TCLDGFSHDDA+K VR AL  GQ+HVE MCSNALAMIKNMTDTD+         TSNNRKL EE    T  VD          GWP WLS GDRRLLQ S V  +  VAADGSG FKT        P+   KRY+I IKAGVYRENVEV KK KNIMF+GDGRTRTIITGSRNVVDGSTTF SATVA VGE FLARDITFQNTAGPSKHQAVALRVG+D SAFYNCDMLAYQDTLYVHS+RQFFV CLIAGTV FIFGNAA VLQ+   +H  +  P +G      +QG+ DPNQ   +
Sbjct:  170 SAITNQETCLDGFSHDDADKQVRKALLKGQIHVEHMCSNALAMIKNMTDTDIANFEQKAKITSNNRKLKEENQETTVAVDIAGAGELDSEGWPTWLSAGDRRLLQGSGVKADATVAADGSGTFKTVAAAVAAAPENSNKRYVIHIKAGVYRENVEVAKKKKNIMFMGDGRTRTIITGSRNVVDGSTTFHSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYNCDMLAYQDTLYVHSNRQFFVKCLIAGTVDFIFGNAAVVLQD-CDIHARR--PNSGQKNMVTAQGRTDPNQNTGI 472          
BLAST of EY756556 vs. ExPASy Swiss-Prot
Match: PME2_ARATH (Pectinesterase 2 OS=Arabidopsis thaliana GN=PME2 PE=2 SV=2)

HSP 1 Score: 365.54 bits (937), Expect = 2.398e-100
Identity = 191/295 (64.75%), Postives = 219/295 (74.24%), Query Frame = 1
Query:   55 AAMTNQGTCLDGFSHDDANKHVRDALSDGQVHVEKMCSNALAMIKNMTDTDMM---------IMRTSNNRKLIEETSTVD--GWPAWLSTGDRRLLQSSSVTPNVVVAADGSGNFKTXXXXXXXXPQGGTKRYIIRIKAGVYRENVEVTKKHKNIMFIGDGRTRTIITGSRNVVDGSTTFKSATVAVVGEGFLARDITFQNTAGPSKHQAVALRVGADLSAFYNCDMLAYQDTLYVHSDRQFFVNCLIAGTVGFIFGNAAAVLQ--NVTSMHESQFPPKNGHSQGKADPNQTPAL 900
            +A+TNQGTCLDGFS+DDA++ VR AL  GQVHVE MCSNALAMIKNMT+TD+              +NNRKL E T  +D  GWP WLS GDRRLLQ S++  +  VA DGSG+F T        P+   KR++I IKAGVYRENVEVTKK  NIMF+GDGR +TIITGSRNVVDGSTTF SATVA VGE FLARDITFQNTAGPSKHQAVALRVG+D SAFY CDM AYQDTLYVHS+RQFFV C I GTV FIFGNAAAVLQ  ++ +   +        +QG++DPNQ   +
Sbjct:  173 SAITNQGTCLDGFSYDDADRKVRKALLKGQVHVEHMCSNALAMIKNMTETDIANFELRDKSSTFTNNNNRKLKEVTGDLDSDGWPKWLSVGDRRLLQGSTIKADATVADDGSGDFTTVAAAVAAAPEKSNKRFVIHIKAGVYRENVEVTKKKTNIMFLGDGRGKTIITGSRNVVDGSTTFHSATVAAVGERFLARDITFQNTAGPSKHQAVALRVGSDFSAFYQCDMFAYQDTLYVHSNRQFFVKCHITGTVDFIFGNAAAVLQDCDINARRPNSGQKNMVTAQGRSDPNQNTGI 467          
BLAST of EY756556 vs. ExPASy Swiss-Prot
Match: PMEU1_SOLLC (Pectinesterase/pectinesterase inhibitor U1 OS=Solanum lycopersicum GN=PMEU1 PE=2 SV=1)

HSP 1 Score: 357.066 bits (915), Expect = 8.527e-98
Identity = 190/291 (65.29%), Postives = 219/291 (75.26%), Query Frame = 1
Query:   55 AAMTNQGTCLDGFSHDDANKHVRDALSDGQVHVEKMCSNALAMIKNMTDTD----MMIMRTSNNRKLIEETSTVDGWPAWLSTGDRRLLQSSSVTPNVVVAADGSGNFKTXXXXXXXXPQGGTKRYIIRIKAGVYRENVEVTKKHKNIMFIGDGRTRTIITGSRNVVDGSTTFKSATVAVVGEGFLARDITFQNTAGPSKHQAVALRVGADLSAFYNCDMLAYQDTLYVHSDRQFFVNCLIAGTVGFIFGNAAAVLQNVTSMHESQFPPKNGH-----SQGKADPNQTPAL 900
            +A+TNQ TCLDGFSHD+A+K VR  L  GQ HVEKMCSNALAMI NMTDTD    M +   +NNRKL+E+      WP WLS GDRRLLQSS+VTP+VVVAADGSG++KT        P+  +KRY+IRIKAGVYRENV+V KK  NIMF+GDG++ TIIT SRNV DGSTTF SATV  V    LARDITFQNTAG SKHQAVAL VG+DLSAFY CDMLAYQDTLYVHS+RQFFV CL+AGTV FIFGN AAV Q+   +H  +  P +G      +QG+ DPNQ   +
Sbjct:  179 SAITNQETCLDGFSHDEADKKVRKVLLKGQKHVEKMCSNALAMICNMTDTDIANEMKLSAPANNRKLVEDNGE---WPEWLSAGDRRLLQSSTVTPDVVVAADGSGDYKTVSEAVRKAPEKSSKRYVIRIKAGVYRENVDVPKKKTNIMFMGDGKSNTIITASRNVQDGSTTFHSATVVRVAGKVLARDITFQNTAGASKHQAVALCVGSDLSAFYRCDMLAYQDTLYVHSNRQFFVQCLVAGTVDFIFGNGAAVFQD-CDIHARR--PGSGQKNMVTAQGRTDPNQNTGI 463          
BLAST of EY756556 vs. ExPASy Swiss-Prot
Match: PME_DAUCA (Pectinesterase OS=Daucus carota PE=1 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 1.516e-70
Identity = 138/202 (68.32%), Postives = 159/202 (78.71%), Query Frame = 1
Query:  310 QSSSVTPNVVVAADGSGNFKTXXXXXXXXPQGGTKRYIIRIKAGVYRENVEVTKKHKNIMFIGDGRTRTIITGSRNVVDGSTTFKSATVAVVGEGFLARDITFQNTAGPSKHQAVALRVGADLSAFYNCDMLAYQDTLYVHSDRQFFVNCLIAGTVGFIFGNAAAVLQNVTSMHESQFPPKNGH-----SQGKADPNQTPAL 900
            QSS+VTPNVVVAADGSG++KT        P+    RY+IRIKAGVYRENV+V KK KNIMF+GDGRT TIIT S+NV DGSTTF SATVA VG GFLARDITFQNTAG +KHQAVALRVG+DLSAFY CD+LAYQD+LYVHS+RQFF+NC IAGTV FIFGNAA VLQ+   +H  +  P +G      +QG+ DPNQ   +
Sbjct:    1 QSSTVTPNVVVAADGSGDYKTVSEAVAAAPEDSKTRYVIRIKAGVYRENVDVPKKKKNIMFLGDGRTSTIITASKNVQDGSTTFNSATVAAVGAGFLARDITFQNTAGAAKHQAVALRVGSDLSAFYRCDILAYQDSLYVHSNRQFFINCFIAGTVDFIFGNAAVVLQD-CDIHARR--PGSGQKNMVTAQGRTDPNQNTGI 199          
BLAST of EY756556 vs. ExPASy Swiss-Prot
Match: PME32_ARATH (Probable pectinesterase/pectinesterase inhibitor 32 OS=Arabidopsis thaliana GN=PME32 PE=2 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 6.168e-64
Identity = 132/281 (46.98%), Postives = 173/281 (61.57%), Query Frame = 1
Query:   55 AAMTNQGTCLDGFSHDDANKHVRDALSDGQVHVEKMCSNALAMIKNMTDTDMMIMRTSNNRKLIEETSTVDGWPAWLSTGDRRLLQSSSVT-PNVVVAADGSGNFKTXXXXXXXXPQGGTKRYIIRIKAGVYRENVEVTKKHKNIMFIGDGRTRTIITGSRNVVDGSTTFKSATVAVVGEGFLARDITFQNTAGPSKHQAVALRVGADLSAFYNCDMLAYQDTLYVHSDRQFFVNCLIAGTVGFIFGNAAAVLQNVTSMHESQFPPKNGH--SQGKADPNQ 888
            AA++NQ TCLDGF  +  N  ++  ++ G   V     N L M+ +         +    + + +  S    +P+W+  GDR+LLQ+ ++T  + VVAADG+GNF T        P   TKRY+I +K GVY ENVE+ KK  NIM +GDG   T+ITG+R+ +DG TTF+SAT AV G GF+ARDITFQNTAGP KHQAVA+R   DL  FY C M  YQDTLY HS RQFF  C+I GTV FIFG+A AV Q+     +   P +     +QG+ DPN+
Sbjct:  125 AALSNQDTCLDGF--EGTNGIIKKIVAGGLSKVGTTVRNLLTMVHSPPSKPKP--KPIKAQTMTKAHSGFSKFPSWVKPGDRKLLQTDNITVADAVVAADGTGNFTTISDAVLAAPDYSTKRYVIHVKRGVYVENVEIKKKKWNIMMVGDGIDATVITGNRSFIDGWTTFRSATFAVSGRGFIARDITFQNTAGPEKHQAVAIRSDTDLGVFYRCAMRGYQDTLYAHSMRQFFRECIITGTVDFIFGDATAVFQSCQIKAKQGLPNQKNSITAQGRKDPNE 401          
BLAST of EY756556 vs. ExPASy Swiss-Prot
Match: PME2_CITSI (Pectinesterase 2 OS=Citrus sinensis GN=PECS-2.1 PE=2 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 3.998e-63
Identity = 140/287 (48.78%), Postives = 177/287 (61.67%), Query Frame = 1
Query:   49 MRAAMTNQGTCLDGFSHDDANKHVRDALSDGQVHVEKMCSNALAMIKNMTDTDMMIMRTSNNRKLIEETSTVDGWPAWLSTGDRRLLQSSSVTPNVVVAADGSGNFKTXXXXXXXXPQGGTKRYIIRIKAGVYRENVEVTKKHKNIMFIGDGRTRTIITGSRNVVDGSTTFKSATVAVVGEGFLARDITFQNTAGPSKHQAVALRVGADLSAFYNCDMLAYQDTLYVHSDRQFFVNCLIAGTVGFIFGNAAAVLQNVTSMHESQFPPKNGH---SQGKADPNQTPAL 900
            +  A+TN  TC          ++V   LS+   +V K+ SN L++                N+    E S  DG+P W+  GDR+LLQ++    N+VVA DGSGN KT         + G  RY+I IKAG Y EN+EV  K KNIMF+GDG  +TIITGS++V  G+TTFKSATVAVVG+ F+ARDIT +NTAGP+ HQAVALR G+DLS FY C    YQDTLYVHS RQF+  C I GTV FIFGNAA VLQN      ++ PP   +   +QG+ DPNQ+  +
Sbjct:  128 LSTALTNLETCRASLEDLGVPEYVLPLLSN---NVTKLISNTLSL----------------NKVPYNEPSYKDGFPTWVKPGDRKLLQTTP-RANIVVAQDGSGNVKTIQEAVAAASRAGGSRYVIYIKAGTYNENIEV--KLKNIMFVGDGIGKTIITGSKSVGGGATTFKSATVAVVGDNFIARDITIRNTAGPNNHQAVALRSGSDLSVFYRCSFEGYQDTLYVHSQRQFYRECDIYGTVDFIFGNAAVVLQNCNIF--ARKPPNRTNTLTAQGRTDPNQSTGI 390          
BLAST of EY756556 vs. ExPASy Swiss-Prot
Match: PME_PRUPE (Pectinesterase/pectinesterase inhibitor PPE8B OS=Prunus persica PE=2 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 7.057e-60
Identity = 125/287 (43.55%), Postives = 172/287 (59.93%), Query Frame = 1
Query:   49 MRAAMTNQGTCLDGFSHDDANKHVRDALSDGQVHVEKMCSNALAMIKNMTDTDMMIMRTSNNRKLIEETSTVDGWPAWLSTGDRRLLQSSSVTPNVVVAADGSGNFKTXXXXXXXXPQGGTKRYIIRIKAGVYRENVEVTKKHKNIMFIGDGRTRTIITGSRNVVDGSTTFKSATVAVVGEGFLARDITFQNTAGPSKHQAVALRVGADLSAFYNCDMLAYQDTLYVHSDRQFFVNCLIAGTVGFIFGNAAAVLQNVTSMHESQFPPKNGH--SQGKADPNQTPALS 903
            + AA+ NQ TC +GF  +  N  V+  +S G   V  +    L  +   ++      +   N ++          P+W+ T DR+LLQ+  V+ + +VA DG+GNF          P    +RY+I IK G Y+ENVE+ KK  N+M IGDG   TII+G+R+ VDG TTF+SAT AV G GF+ARDITF+NTAGP KHQAVALR  +DLS FY C++  YQDTLY H+ RQF+ +C I+GTV FIFG+A  V QN   + +   P +     +QG+ DPN+   +S
Sbjct:  132 LSAALVNQDTCSNGF--EGTNSIVQGLISAGLGQVTSLVQELLTQVHPNSN------QQGPNGQI----------PSWVKTKDRKLLQADGVSVDAIVAQDGTGNFTNVTDAVLAAPDYSMRRYVIYIKRGTYKENVEIKKKKWNLMMIGDGMDATIISGNRSFVDGWTTFRSATFAVSGRGFIARDITFENTAGPEKHQAVALRSDSDLSVFYRCNIRGYQDTLYTHTMRQFYRDCKISGTVDFIFGDATVVFQNCQILAKKGLPNQKNSITAQGRKDPNEPTGIS 400          
BLAST of EY756556 vs. ExPASy Swiss-Prot
Match: PME34_ARATH (Probable pectinesterase/pectinesterase inhibitor 34 OS=Arabidopsis thaliana GN=PME34 PE=2 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 2.053e-59
Identity = 122/290 (42.07%), Postives = 178/290 (61.38%), Query Frame = 1
Query:   49 MRAAMTNQGTCLDGFSHDDANKHVRDALSDGQVHVEKMCSNALAMIKNMTDTDMMIMRTSNNRKLIEETSTVDGWPAWLSTGDRRLLQS--SSVTPNVVVAADGSGNFKTXXXXXXXXPQGGTKRYIIRIKAGVYREN-VEVTKKHKNIMFIGDGRTRTIITGSRNVVDGSTTFKSATVAVVGEGFLARDITFQNTAGPSKHQAVALRVGADLSAFYNCDMLAYQDTLYVHSDRQFFVNCLIAGTVGFIFGNAAAVLQN--VTSMHESQFPPKNGHSQGKADPNQTPALS 903
            + AA+TN  TC +GF   D +  V+D ++    ++ ++ SN LA+     D D        NR+L+      + +P W+   +R +L+   S +  +++V+ DG+G  KT        PQ  T+R II +KAG Y EN ++V +K  N+MF+GDG+ +T+I+G +++ D  TTF +A+ A  G GF+ARDITF+N AGP+KHQAVALR+GAD +  Y C+++ YQDTLYVHS+RQFF  C I GTV FIFGNAA VLQN  + +     F      +Q + DPNQ   +S
Sbjct:  189 LSAALTNHDTCTEGFDGVD-DGGVKDHMTAALQNLSELVSNCLAIFSASHDGDDFAGVPIQNRRLLGVEEREEKFPRWMRPKEREILEMPVSQIQADIIVSKDGNGTCKTISEAIKKAPQNSTRRIIIYVKAGRYEENNLKVGRKKINLMFVGDGKGKTVISGGKSIFDNITTFHTASFAATGAGFIARDITFENWAGPAKHQAVALRIGADHAVIYRCNIIGYQDTLYVHSNRQFFRECDIYGTVDFIFGNAAVVLQNCSIYARKPMDFQKNTITAQNRKDPNQNTGIS 477          
The following BLAST results are available for this feature:
BLAST of EY756556 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 86
Match NameE-valueIdentityDescription
PME3_CITSI6.895e-14088.24Pectinesterase 3 OS=Citrus sinensis PE=1 SV=1[more]
PME1_CITSI3.203e-13786.51Pectinesterase 1 OS=Citrus sinensis GN=PECS-1.1 PE... [more]
PME3_ARATH6.514e-10667.97Pectinesterase/pectinesterase inhibitor 3 OS=Arabi... [more]
PME2_ARATH2.398e-10064.75Pectinesterase 2 OS=Arabidopsis thaliana GN=PME2 P... [more]
PMEU1_SOLLC8.527e-9865.29Pectinesterase/pectinesterase inhibitor U1 OS=Sola... [more]
PME_DAUCA1.516e-7068.32Pectinesterase OS=Daucus carota PE=1 SV=1[more]
PME32_ARATH6.168e-6446.98Probable pectinesterase/pectinesterase inhibitor 3... [more]
PME2_CITSI3.998e-6348.78Pectinesterase 2 OS=Citrus sinensis GN=PECS-2.1 PE... [more]
PME_PRUPE7.057e-6043.55Pectinesterase/pectinesterase inhibitor PPE8B OS=P... [more]
PME34_ARATH2.053e-5942.07Probable pectinesterase/pectinesterase inhibitor 3... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-009-H12-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756556 ID=EY756556|Name=EY756556|organism=Citrus sinensis|type=EST|length=937bp
TGCGGTACCGGTCCGGATTCTTTCGTAGAGCCCGCGTCCGAAAACCCTAT
GCGTGCCGCGATGACCAATCAGGGGACGTGTCTTGATGGGTTCTCTCATG
ATGATGCTAATAAGCACGTGCGGGATGCGTTGTCAGACGGCCAGGTTCAT
GTTGAGAAGATGTGTAGCAATGCGCTTGCTATGATCAAGAACATGACTGA
CACTGACATGATGATCATGAGGACTTCAAACAACAGGAAGCTGATAGAGG
AGACCAGTACGGTTGATGGGTGGCCGGCGTGGCTGTCCACCGGAGACAGG
AGGCTGTTGCAGTCCTCGTCGGTGACACCGAACGTGGTGGTGGCAGCAGA
TGGCAGCGGAAACTTTAAGACGGTGGCGGCAGCGGTGGCGGCGGCTCCTC
AGGGAGGCACTAAGCGGTATATTATTAGGATTAAAGCCGGTGTTTATCGG
GAAAATGTTGAGGTGACAAAGAAGCATAAAAATATAATGTTCATCGGTGA
CGGGAGGACTAGAACTATCATCACAGGAAGTAGAAATGTGGTTGATGGAA
GCACAACTTTCAAGTCTGCTACAGTTGCTGTTGTTGGTGAAGGATTCTTG
GCCCGAGACATTACATTCCAAAACACAGCCGGCCCCTCAAAGCACCAGGC
GGTGGCACTACGAGTGGGAGCTGACCTTTCAGCATTTTACAATTGCGATA
TGTTAGCTTACCAAGACACACTCTACGTCCACTCCGACCGCCAGTTCTTT
GTGAACTGCTTAATTGCTGGCACGGTTGGATTTATTTTTGGTAACGCTGC
AGCCGTGTTACAAAATGTGACATCCATGCACGAAAGCCAATTCCCGCCAA
AAAATGGTCACAGCCAAGGCAAGGCTGACCCTAACCAAACACCGGCATTG
TCATCCAAAATCTAGGATTGGTGCCCCTCCCATTTAA
back to top