EY756555

Overview
NameEY756555
Unique NameEY756555
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length887
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY756555 vs. ExPASy Swiss-Prot
Match: Y1491_ARATH (DUF246 domain-containing protein At1g04910 OS=Arabidopsis thaliana GN=At1g04910 PE=1 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 2.740e-42
Identity = 79/191 (41.36%), Postives = 116/191 (60.73%), Query Frame = 3
Query:   12 GLNQMRAAICDMVAIARYLNVTLIVPELDKTSFWADPSEFQDIFDVDHFITSLRDEVRILKELPPRLKK-RVEMGRVLSMPPISWSDISYYHNQILPLVQKYKVVHLNRTDARLANNGQPLEIQKLRCRVNFSALRFTSQIEDLGKRVIKLLRQNGPFLVLHLRYEMDMLAFSGCTQGCNKEEVEELTRMR 581
            GLNQ R+AIC+ V  AR +N TL++PELD  SFW D S FQ I+DV+HFI +L+ +V+I+ ++P   K  + +  +   + P   + I +Y    L  ++++  ++L     RLA      E Q+LRCRVN+ ALRF   I  L + ++  LR  G F+ +HLR+EMDMLAF+GC    N EE + L + R
Sbjct:   99 GLNQQRSAICNAVLAARIMNATLVLPELDANSFWHDDSGFQGIYDVEHFIETLKYDVKIVGKIPDVHKNGKTKKIKAFQIRPPRDAPIEWYLTTALKAMREHSAIYLTPFSHRLAEEIDNPEYQRLRCRVNYHALRFKPHIMKLSESIVDKLRSQGHFMSIHLRFEMDMLAFAGCFDIFNPEEQKILRKYR 289          

HSP 2 Score: 45.4394 bits (106), Expect = 2.740e-42
Identity = 21/37 (56.76%), Postives = 26/37 (70.27%), Query Frame = 1
Query:  637 GLCPLTPEETALILRALDIDPNMQIYIAAGEYTXAER 747
            G CPLTPEE  LILRA+  D + +IY+AAGE    E+
Sbjct:  307 GKCPLTPEEVGLILRAMRFDNSTRIYLAAGELFGGEQ 343          
The following BLAST results are available for this feature:
BLAST of EY756555 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
Y1491_ARATH2.740e-4241.36DUF246 domain-containing protein At1g04910 OS=Arab... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-009-H11-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756555 ID=EY756555|Name=EY756555|organism=Citrus sinensis|type=EST|length=887bp
CCACGCGTCCGGGTCTCAATCAGATGAGAGCAGCGATTTGTGACATGGTG
GCTATTGCAAGATATCTGAATGTCACTCTTATAGTCCCTGAATTGGATAA
AACTTCCTTCTGGGCTGATCCTAGTGAGTTCCAAGATATATTTGATGTGG
ATCATTTTATTACATCATTGAGAGATGAGGTGCGGATACTGAAAGAGTTG
CCTCCTAGGCTGAAGAAGAGAGTGGAAATGGGAAGGGTTTTGTCCATGCC
ACCAATTAGTTGGTCTGATATATCTTACTATCACAATCAGATTCTTCCCC
TGGTACAGAAGTACAAAGTTGTACATCTCAACAGAACTGATGCTCGACTT
GCCAATAATGGTCAGCCTTTAGAGATTCAGAAACTGCGTTGCCGTGTAAA
TTTTAGTGCTTTGAGATTCACCTCTCAAATTGAAGATTTGGGTAAAAGAG
TTATCAAGCTTCTACGGCAGAATGGTCCTTTTCTTGTACTTCATCTTAGA
TATGAAATGGACATGTTGGCATTTTCTGGCTGCACTCAAGGTTGCAACAA
AGAGGAGGTGGAAGAACTCACAAGGATGAGATATGCTTATCCTTGGTGGA
AAGAGAAATAATAAATTCTGACTTGAAGATGAAGATGGATTGTGCCCTTT
GACACCTGAGGAAACAGCTCTTATATTGAGGGCCCTGGACATTGATCCTA
ATATGCAGATTTACATCGCAGCTGGTGAATATACNGNGGCGGAAAGGAGA
TGGCAAATCTTGCTAAAGCTTATCCAAATGGCTCAGAAAAGAAACGCTCT
GGAACATCAAACCTTAAGTTTTTCCAAACCATTCATCCCAATGGCAGCCC
TAAATTATCCCGTTCATTGGAGAGGATATATTGGTTC
back to top