EY756552

Overview
NameEY756552
Unique NameEY756552
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length508
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7383 contig Csv1_Contig7383:241..748. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756552 vs. ExPASy Swiss-Prot
Match: SYD_ARCB4 (Aspartyl-tRNA synthetase OS=Arcobacter butzleri (strain RM4018) GN=aspS PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 8.688e-12
Identity = 32/48 (66.67%), Postives = 43/48 (89.58%), Query Frame = 3
Query:   12 RLVMLLAGTNSIRDVIAFPKTTTAQCVLTRSPSEVDPQQLQELSLQTK 155
            R++MLLAGT+SIRDVIAFPKT  AQC+LT++PS VD +QL+ELS++ +
Sbjct:  536 RMIMLLAGTDSIRDVIAFPKTQKAQCLLTQAPSAVDEEQLKELSIRIR 583          
BLAST of EY756552 vs. ExPASy Swiss-Prot
Match: SYD_SULNB (Aspartyl-tRNA synthetase OS=Sulfurovum sp. (strain NBC37-1) GN=aspS PE=3 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 5.631e-11
Identity = 29/48 (60.42%), Postives = 42/48 (87.50%), Query Frame = 3
Query:   12 RLVMLLAGTNSIRDVIAFPKTTTAQCVLTRSPSEVDPQQLQELSLQTK 155
            R++M++ G +SIRDVIAFPKT  AQC+LT++PSEVD +QL+ELS++ +
Sbjct:  531 RMIMIMTGASSIRDVIAFPKTQKAQCLLTQAPSEVDNEQLKELSIRVR 578          
BLAST of EY756552 vs. ExPASy Swiss-Prot
Match: SYD_LYSSC (Aspartyl-tRNA synthetase OS=Lysinibacillus sphaericus (strain C3-41) GN=aspS PE=3 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 9.605e-11
Identity = 31/50 (62.00%), Postives = 39/50 (78.00%), Query Frame = 3
Query:   12 RLVMLLAGTNSIRDVIAFPKTTTAQCVLTRSPSEVDPQQLQELSLQTK*F 161
            R VMLLAG +++RD IAFPKT +A C++T +PSEV P+QL ELSL  K F
Sbjct:  538 RFVMLLAGRHNLRDTIAFPKTASASCLMTEAPSEVSPEQLSELSLAIKPF 587          
BLAST of EY756552 vs. ExPASy Swiss-Prot
Match: SYD_ALTMD (Aspartyl-tRNA synthetase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=aspS PE=3 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 9.605e-11
Identity = 31/47 (65.96%), Postives = 38/47 (80.85%), Query Frame = 3
Query:   12 RLVMLLAGTNSIRDVIAFPKTTTAQCVLTRSPSEVDPQQLQELSLQT 152
            RLVML+ G  SIRDV+AFPKTTTA C LT +PS  +PQQL+EL++ T
Sbjct:  535 RLVMLMTGATSIRDVMAFPKTTTAACPLTSAPSPANPQQLEELAIAT 581          
The following BLAST results are available for this feature:
BLAST of EY756552 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
SYD_ARCB48.688e-1266.67Aspartyl-tRNA synthetase OS=Arcobacter butzleri (s... [more]
SYD_SULNB5.631e-1160.42Aspartyl-tRNA synthetase OS=Sulfurovum sp. (strain... [more]
SYD_LYSSC9.605e-1162.00Aspartyl-tRNA synthetase OS=Lysinibacillus sphaeri... [more]
SYD_ALTMD9.605e-1165.96Aspartyl-tRNA synthetase OS=Alteromonas macleodii ... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-009-H08-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756552 ID=EY756552|Name=EY756552|organism=Citrus sinensis|type=EST|length=508bp
CCACGCGTCCGAGGCTGGTTATGTTGTTGGCAGGCACGAATTCCATCAGG
GATGTTATCGCCTTCCCAAAGACAACAACCGCTCAGTGTGTCCTCACAAG
GTCTCCATCAGAGGTGGATCCCCAGCAGCTACAAGAACTATCATTACAGA
CCAAATAGTTTCACGTCAGTGGTATGCCAAACATCGACTTTAGCCGGACC
AGTGTTCACTGTCCTGAATATGTTTGAGATAATTGAGCTGTTTTTACATG
CACTAGGTTCTACTTTTAGGTGAGGGTATTAATAGTATGTTTGTGAACAA
AAACAGGCCGTGTATGTTAGTGTTCTATATTCGTTTACCCTGAGTAATTA
AATTATAATTCATAAGTGAACGTTGTGCCCATGTAACCAGCATTGGCCAT
TATGAATGCACCTCAGTGAATTGAAAACTTTTATCTTGGACTAGGTCATT
GAATTTGTTAAAATTTGAGAGTGCTTGTAAATTATATAAGGGATATTATT
ATTTTACC
back to top