EY756552
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of EY756552 vs. ExPASy Swiss-Prot
Match: SYD_ARCB4 (Aspartyl-tRNA synthetase OS=Arcobacter butzleri (strain RM4018) GN=aspS PE=3 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 8.688e-12 Identity = 32/48 (66.67%), Postives = 43/48 (89.58%), Query Frame = 3 Query: 12 RLVMLLAGTNSIRDVIAFPKTTTAQCVLTRSPSEVDPQQLQELSLQTK 155 R++MLLAGT+SIRDVIAFPKT AQC+LT++PS VD +QL+ELS++ + Sbjct: 536 RMIMLLAGTDSIRDVIAFPKTQKAQCLLTQAPSAVDEEQLKELSIRIR 583
BLAST of EY756552 vs. ExPASy Swiss-Prot
Match: SYD_SULNB (Aspartyl-tRNA synthetase OS=Sulfurovum sp. (strain NBC37-1) GN=aspS PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 5.631e-11 Identity = 29/48 (60.42%), Postives = 42/48 (87.50%), Query Frame = 3 Query: 12 RLVMLLAGTNSIRDVIAFPKTTTAQCVLTRSPSEVDPQQLQELSLQTK 155 R++M++ G +SIRDVIAFPKT AQC+LT++PSEVD +QL+ELS++ + Sbjct: 531 RMIMIMTGASSIRDVIAFPKTQKAQCLLTQAPSEVDNEQLKELSIRVR 578
BLAST of EY756552 vs. ExPASy Swiss-Prot
Match: SYD_LYSSC (Aspartyl-tRNA synthetase OS=Lysinibacillus sphaericus (strain C3-41) GN=aspS PE=3 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 9.605e-11 Identity = 31/50 (62.00%), Postives = 39/50 (78.00%), Query Frame = 3 Query: 12 RLVMLLAGTNSIRDVIAFPKTTTAQCVLTRSPSEVDPQQLQELSLQTK*F 161 R VMLLAG +++RD IAFPKT +A C++T +PSEV P+QL ELSL K F Sbjct: 538 RFVMLLAGRHNLRDTIAFPKTASASCLMTEAPSEVSPEQLSELSLAIKPF 587
BLAST of EY756552 vs. ExPASy Swiss-Prot
Match: SYD_ALTMD (Aspartyl-tRNA synthetase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=aspS PE=3 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 9.605e-11 Identity = 31/47 (65.96%), Postives = 38/47 (80.85%), Query Frame = 3 Query: 12 RLVMLLAGTNSIRDVIAFPKTTTAQCVLTRSPSEVDPQQLQELSLQT 152 RLVML+ G SIRDV+AFPKTTTA C LT +PS +PQQL+EL++ T Sbjct: 535 RLVMLMTGATSIRDVMAFPKTTTAACPLTSAPSPANPQQLEELAIAT 581 The following BLAST results are available for this feature:
BLAST of EY756552 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 4
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY756552 ID=EY756552; Name=EY756552; organism=Citrus sinensis; type=EST; length=508bpback to top |