EY756521

Overview
NameEY756521
Unique NameEY756521
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length562
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY756521 vs. ExPASy Swiss-Prot
Match: TOM7A_ARATH (Mitochondrial import receptor subunit TOM7-1 OS=Arabidopsis thaliana GN=TOM7-1 PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 4.575e-18
Identity = 44/70 (62.86%), Postives = 54/70 (77.14%), Query Frame = 3
Query:  183 MSSRITLKT---KGKSVKGAKDSE-KSRADCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSDPKPQLYQ 380
            M S I+LK    KGK  KGA  S+ KS+ D +KEW+ W++KKAKV+THYGFIPLVI +GMNSDPKP L+Q
Sbjct:    1 MESTISLKVNKGKGKGSKGASSSDDKSKFDVVKEWTNWSLKKAKVVTHYGFIPLVIFVGMNSDPKPHLFQ 70          
BLAST of EY756521 vs. ExPASy Swiss-Prot
Match: TOM7B_ARATH (Mitochondrial import receptor subunit TOM7-2 OS=Arabidopsis thaliana GN=TOM7-2 PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.055e-14
Identity = 39/71 (54.93%), Postives = 51/71 (71.83%), Query Frame = 3
Query:  183 MSSRITLKTKGKSV--KGAKDSEKSRADC----LKEWSTWAMKKAKVITHYGFIPLVIIIGMNSDPKPQLY 377
            M+++ TLK KGK+   KG+  S  S A       K+W+ W+++KAKV THYGFIPL+IIIGMNSDPKP L+
Sbjct:    1 MAAKSTLKIKGKAKPSKGSSSSSSSSASSKYKVFKDWTNWSLQKAKVATHYGFIPLIIIIGMNSDPKPHLF 71          
BLAST of EY756521 vs. ExPASy Swiss-Prot
Match: TOM7A_SOLTU (Mitochondrial import receptor subunit TOM7-1 OS=Solanum tuberosum GN=TOM7-1 PE=3 SV=3)

HSP 1 Score: 76.6406 bits (187), Expect = 8.928e-14
Identity = 39/66 (59.09%), Postives = 45/66 (68.18%), Query Frame = 3
Query:  201 LKTKGKSVKGAKDSEKSRADC------LKEWSTWAMKKAKVITHYGFIPLVIIIGMNSDPKPQLYQ 380
            LK KGK+ K A  +++           +KEW TW  KKAKVITHYGFIPLVIIIGMNS+PKP L Q
Sbjct:    2 LKPKGKNTKKAAAADEDDGAVAVVGKFVKEWGTWTAKKAKVITHYGFIPLVIIIGMNSEPKPSLSQ 67          
The following BLAST results are available for this feature:
BLAST of EY756521 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
TOM7A_ARATH4.575e-1862.86Mitochondrial import receptor subunit TOM7-1 OS=Ar... [more]
TOM7B_ARATH1.055e-1454.93Mitochondrial import receptor subunit TOM7-2 OS=Ar... [more]
TOM7A_SOLTU8.928e-1459.09Mitochondrial import receptor subunit TOM7-1 OS=So... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-009-E11-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756521 ID=EY756521|Name=EY756521|organism=Citrus sinensis|type=EST|length=562bp
CCACGCGTCCGGCACACGGAACAATCGCCCATCATCTTCTCAACACATCG
TCCAGTCATCTGCCGCCTCCGGCACTTCCATCTGTCTCCGTTAGCCCACT
GGAATCGTTCAACTTAGGTGCATAATCTGTTGGGGGTTAATAGCCAAAGC
TAACCCAGCAAAGGAGAGAGAGTGAGGATAAAATGAGTTCAAGAATAACA
CTTAAGACTAAAGGCAAGAGTGTGAAGGGAGCAAAAGATTCAGAGAAATC
AAGAGCAGATTGTTTGAAAGAGTGGAGCACTTGGGCCATGAAAAAGGCTA
AAGTCATCACTCACTATGGCTTCATTCCTCTTGTCATCATCATCGGCATG
AACTCTGACCCCAAGCCCCAGCTCTATCAGCTCCTCAGCCCCGTGTGATC
TTCTTAACTTTTTCCTCCTCCTTGACATGCTGCTTTGCTATGTAAGCTTA
TAGATCAACTCTGCCTGGTGTAATATGTCCAAAGTTTGAACTCTCTATCT
CTTCATTGAATCTAAGTCTTCTCTTCCTTGTTGTCAAAAAAAAAAAAAAA
AAAAAAAAAAAA
back to top