EY756521
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY756521 vs. ExPASy Swiss-Prot
Match: TOM7A_ARATH (Mitochondrial import receptor subunit TOM7-1 OS=Arabidopsis thaliana GN=TOM7-1 PE=1 SV=1) HSP 1 Score: 90.8929 bits (224), Expect = 4.575e-18 Identity = 44/70 (62.86%), Postives = 54/70 (77.14%), Query Frame = 3 Query: 183 MSSRITLKT---KGKSVKGAKDSE-KSRADCLKEWSTWAMKKAKVITHYGFIPLVIIIGMNSDPKPQLYQ 380 M S I+LK KGK KGA S+ KS+ D +KEW+ W++KKAKV+THYGFIPLVI +GMNSDPKP L+Q Sbjct: 1 MESTISLKVNKGKGKGSKGASSSDDKSKFDVVKEWTNWSLKKAKVVTHYGFIPLVIFVGMNSDPKPHLFQ 70
BLAST of EY756521 vs. ExPASy Swiss-Prot
Match: TOM7B_ARATH (Mitochondrial import receptor subunit TOM7-2 OS=Arabidopsis thaliana GN=TOM7-2 PE=3 SV=1) HSP 1 Score: 79.7221 bits (195), Expect = 1.055e-14 Identity = 39/71 (54.93%), Postives = 51/71 (71.83%), Query Frame = 3 Query: 183 MSSRITLKTKGKSV--KGAKDSEKSRADC----LKEWSTWAMKKAKVITHYGFIPLVIIIGMNSDPKPQLY 377 M+++ TLK KGK+ KG+ S S A K+W+ W+++KAKV THYGFIPL+IIIGMNSDPKP L+ Sbjct: 1 MAAKSTLKIKGKAKPSKGSSSSSSSSASSKYKVFKDWTNWSLQKAKVATHYGFIPLIIIIGMNSDPKPHLF 71
BLAST of EY756521 vs. ExPASy Swiss-Prot
Match: TOM7A_SOLTU (Mitochondrial import receptor subunit TOM7-1 OS=Solanum tuberosum GN=TOM7-1 PE=3 SV=3) HSP 1 Score: 76.6406 bits (187), Expect = 8.928e-14 Identity = 39/66 (59.09%), Postives = 45/66 (68.18%), Query Frame = 3 Query: 201 LKTKGKSVKGAKDSEKSRADC------LKEWSTWAMKKAKVITHYGFIPLVIIIGMNSDPKPQLYQ 380 LK KGK+ K A +++ +KEW TW KKAKVITHYGFIPLVIIIGMNS+PKP L Q Sbjct: 2 LKPKGKNTKKAAAADEDDGAVAVVGKFVKEWGTWTAKKAKVITHYGFIPLVIIIGMNSEPKPSLSQ 67 The following BLAST results are available for this feature:
BLAST of EY756521 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 3
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >EY756521 ID=EY756521; Name=EY756521; organism=Citrus sinensis; type=EST; length=562bpback to top |