EY756518

Overview
NameEY756518
Unique NameEY756518
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length901
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig11002 contig Csv1_Contig11002:37..938. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756518 vs. ExPASy Swiss-Prot
Match: CB4A_SOLLC (Chlorophyll a-b binding protein CP24 10A, chloroplastic OS=Solanum lycopersicum GN=CAP10A PE=3 SV=1)

HSP 1 Score: 349.747 bits (896), Expect = 3.856e-101
Identity = 169/206 (82.04%), Postives = 179/206 (86.89%), Query Frame = 1
Query:   61 AATSGAVLNGLGSSFINGGKKSQALLAG--TNRVTXXXXXXXXXXLPP--KKSWIPAVKGGGNLINPEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTL 666
            A TS AVLNGL SSF+ GG KSQALLA     RV           L    KKSWIPAV+GGGNL++PEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAV+GIFVGQAWSGIPWFEAGADPGAIAPFSFG+LLGTQL+LMGWVESKRWVDFF+P+SQSVEWATPWS+TAENFAN TGEQGYPGGKFFDPL LAGTL
Sbjct:    2 ATTSAAVLNGLSSSFLTGGNKSQALLAAPLAARVGGAATPKRFTVLAAAAKKSWIPAVRGGGNLVDPEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVLGIFVGQAWSGIPWFEAGADPGAIAPFSFGTLLGTQLILMGWVESKRWVDFFDPDSQSVEWATPWSKTAENFANFTGEQGYPGGKFFDPLALAGTL 207          

HSP 2 Score: 40.0466 bits (92), Expect = 3.856e-101
Identity = 18/25 (72.00%), Postives = 21/25 (84.00%), Query Frame = 2
Query:  728 HARLAMVAMXIFYFEAGQARRHLGS 802
            HARLAM+AM IFYFEAGQ +  LG+
Sbjct:  229 HARLAMLAMLIFYFEAGQGKTPLGA 253          
BLAST of EY756518 vs. ExPASy Swiss-Prot
Match: CB4B_SOLLC (Chlorophyll a-b binding protein CP24 10B, chloroplastic OS=Solanum lycopersicum GN=CAP10B PE=3 SV=1)

HSP 1 Score: 347.051 bits (889), Expect = 5.509e-100
Identity = 166/207 (80.19%), Postives = 180/207 (86.96%), Query Frame = 1
Query:   55 MAAATSGAVLNGLGSSFINGGKKSQALLAG--TNRVTXXXXXXXXXX-LPPKKSWIPAVKGGGNLINPEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTL 666
            M   ++ AVLNGL SSF+ GGKK+QALL    T RVT           + PKKSWIPAVK GGNL++PEWLDGSLPGD+GFDPLGLGKDPAFLKWYREAELIHGRWAMAAV+GIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFF+ +SQS++WATPWS+TAENFAN TGEQGYPGGKFFDPL LAGTL
Sbjct:    1 MTTTSATAVLNGLSSSFLTGGKKTQALLGAHVTARVTTPKRFVVAAAAVAPKKSWIPAVKSGGNLVDPEWLDGSLPGDFGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVLGIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFDNDSQSIDWATPWSKTAENFANFTGEQGYPGGKFFDPLALAGTL 207          

HSP 2 Score: 38.891 bits (89), Expect = 5.509e-100
Identity = 17/25 (68.00%), Postives = 21/25 (84.00%), Query Frame = 2
Query:  728 HARLAMVAMXIFYFEAGQARRHLGS 802
            H+RLAM+AM IFYFEAGQ +  LG+
Sbjct:  229 HSRLAMLAMLIFYFEAGQGKTPLGA 253          
BLAST of EY756518 vs. ExPASy Swiss-Prot
Match: CB4_SPIOL (Chlorophyll a-b binding protein CP24, chloroplastic OS=Spinacia oleracea PE=2 SV=1)

HSP 1 Score: 339.732 bits (870), Expect = 3.880e-98
Identity = 163/212 (76.89%), Postives = 182/212 (85.85%), Query Frame = 1
Query:   55 MAAATSG-AVLNGLGSSFINGGKKS-QALLAGTNRV------TXXXXXXXXXXLPPKKSWIPAVKGGGNLINPEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTL 666
            MAAATS  A++NG  S F++GGKKS Q+LL   ++V      T            PKKSWIPAVKGGGN ++PEWLDGSLPGD+GFDPLGLGKDPAFLKWYREAELIHGRWAM AV+GIFVGQAW+GIPWFEAGADPGA+APFSFG+LLGTQLLLMGWVESKRWVDFF+P+SQSVEWATPWSRTAENF+N+TGEQGYPGGKFFDPL LAGT+
Sbjct:    1 MAAATSATAIVNGFTSPFLSGGKKSSQSLLFVNSKVGAGVSTTSRKLVVVAAAAAPKKSWIPAVKGGGNFLDPEWLDGSLPGDFGFDPLGLGKDPAFLKWYREAELIHGRWAMLAVLGIFVGQAWTGIPWFEAGADPGAVAPFSFGTLLGTQLLLMGWVESKRWVDFFDPDSQSVEWATPWSRTAENFSNSTGEQGYPGGKFFDPLSLAGTI 212          

HSP 2 Score: 40.0466 bits (92), Expect = 3.880e-98
Identity = 18/25 (72.00%), Postives = 21/25 (84.00%), Query Frame = 2
Query:  728 HARLAMVAMXIFYFEAGQARRHLGS 802
            HARLAM+AM IFYFEAGQ +  LG+
Sbjct:  234 HARLAMLAMLIFYFEAGQGKTPLGA 258          
BLAST of EY756518 vs. ExPASy Swiss-Prot
Match: CB12_PETHY (Chlorophyll a-b binding protein, chloroplastic OS=Petunia hybrida PE=2 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 6.985e-25
Identity = 62/158 (39.24%), Postives = 81/158 (51.27%), Query Frame = 1
Query:  193 PPKKSWIPAVKGGGNLINPEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGI------PWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPL 648
            P +  W P          PEWLDGSLPGD+GFDPLGLG DP  LKW  +AEL+H RWAM    GIF+ +  + I       W+ AG            +L   +L+L+GW E +RW D   P   + +   P ++          + GYPGG +FDPL
Sbjct:   63 PDRPLWFPGSTP------PEWLDGSLPGDFGFDPLGLGSDPESLKWNAQAELVHSRWAMLGAAGIFIPEFLTKIGVLNTPSWYTAGEQEYFT---DTTTLFVIELVLIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGT------DVGYPGGLWFDPL 205          
BLAST of EY756518 vs. ExPASy Swiss-Prot
Match: CB12_SOLLC (Chlorophyll a-b binding protein 7, chloroplastic OS=Solanum lycopersicum GN=CAB7 PE=3 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 3.467e-24
Identity = 67/209 (32.06%), Postives = 99/209 (47.37%), Query Frame = 1
Query:   40 VEIISMAAATSGAVLNGLGSSFINGGKKSQALLAGTNRVTXXXXXXXXXXLPPKKSWIPAVKGGGNLINPEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGI------PWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPL 648
            V   S ++  +G+++    +SF+ GG++ +     T               P +  W P          P WLDGSLPGD+GFDPLGL  DP  L+W ++AEL+H RWAM    GIF+ +  + I       W+ AG            +L   +L+L+GW E +RW D   P   + +   P ++          + GYPGG +FDPL
Sbjct:   13 VAFSSPSSRRNGSIVGTTKASFL-GGRRLRVSKYSTTPTARSATTVCVAADPDRPLWFPGSTP------PPWLDGSLPGDFGFDPLGLASDPESLRWNQQAELVHCRWAMLGAAGIFIPELLTKIGILNTPSWYTAGEQEYFT---DTTTLFIVELVLIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGT------DVGYPGGLWFDPL 205          
BLAST of EY756518 vs. ExPASy Swiss-Prot
Match: CB24_PEA (Chlorophyll a-b binding protein P4, chloroplastic OS=Pisum sativum GN=lhcA-P4 PE=1 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 4.685e-21
Identity = 61/162 (37.65%), Postives = 88/162 (54.32%), Query Frame = 1
Query:  199 KKSWIPAVKGGGNLINPEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGI------PWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTL 666
            K  W+P       L +P +L GSLPGD GFDPLGL +DP  L+W+ +AEL++GRWAM  V G+ + + ++ I       W+ AG +       S  +L   + +L  +VE +RW D  NP S + +         + ++   GE GYPGG  F+PL  A TL
Sbjct:   53 KGEWLPG------LASPGYLTGSLPGDNGFDPLGLAEDPENLRWFVQAELVNGRWAMLGVAGMLLPEVFTSIGIINVPKWYAAGKEEYFA---SSSTLFVIEFILSHYVEIRRWQDIKNPGSVNQD------PIFKQYSLPAGEVGYPGG-IFNPLNFAPTL 198          
BLAST of EY756518 vs. ExPASy Swiss-Prot
Match: CB24_ARATH (Chlorophyll a-b binding protein 4, chloroplastic OS=Arabidopsis thaliana GN=CAB4 PE=1 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 1.363e-20
Identity = 60/161 (37.27%), Postives = 88/161 (54.66%), Query Frame = 1
Query:  199 KKSWIPAVKGGGNLINPEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGI------PWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGT 663
            K  W+P       L +P++L GSL GD GFDPLGL +DP  LKW+ +AEL++GRWAM  V G+ + + ++ I       W++AG +       S  +L   + +L  +VE +RW D  NP S + +         + ++   GE GYPGG  F+PL  A T
Sbjct:   54 KGEWLPG------LASPDYLTGSLAGDNGFDPLGLAEDPENLKWFVQAELVNGRWAMLGVAGMLLPEVFTKIGIINVPEWYDAGKEQYFA---SSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQD------PIFKQYSLPKGEVGYPGG-IFNPLNFAPT 198          
BLAST of EY756518 vs. ExPASy Swiss-Prot
Match: CB4B_ARATH (Chlorophyll a-b binding protein CP29.2, chloroplastic OS=Arabidopsis thaliana GN=LHCB4.2 PE=1 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.660e-16
Identity = 63/201 (31.34%), Postives = 86/201 (42.79%), Query Frame = 1
Query:  208 WIPAVKGGGNLINPEWLDGSLPGDYGFDPLGLGKDPAFLKW-------------------------------------------YREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAG--------ADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLA 657
            W P  K      +PE+LDGSL GDYGFDP GLGK   +L++                                           +RE ELIHGRWAM A +G    +  +G+ W +AG        +  G   PFS  +L+  ++L++G++E +R     N E  S                   ++ YPGGKFFDPL LA
Sbjct:   55 WFPGAK------SPEYLDGSLVGDYGFDPFGLGKPAEYLQFDLDSLDQNLAKNLYGEVIGTRTEAVDPKSTPFQPYSEVFGLQRFRECELIHGRWAMLATLGAITVEWLTGVTWQDAGKVELVDGSSYLGQPLPFSISTLIWIEVLVIGYIEFQR-----NAELDS------------------EKRLYPGGKFFDPLGLA 226          
BLAST of EY756518 vs. ExPASy Swiss-Prot
Match: CB120_HORVU (Chlorophyll a-b binding protein 1B-20, chloroplastic (Fragment) OS=Hordeum vulgare GN=LHC Ib-20 PE=1 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 5.017e-15
Identity = 52/156 (33.33%), Postives = 81/156 (51.92%), Query Frame = 1
Query:  199 KKSWIPAVKGGGNLINPEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAG---ADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLA 657
            K SW+P ++      +P +LDGSL GD GFDPL L +DP  L+W+ +A++++GRWAM  V G+ + +  +      A      PG    F+  S      +   +VE +RW D  NP S + +         ++++    E GYP G+ F+PL  A
Sbjct:   33 KGSWLPGLQ------SPAYLDGSLEGDNGFDPLALAEDPEDLRWFVQADVVNGRWAMLGVAGMLIPEVLTKAGLMNAPEWLRLPGKETYFASSSTALRVHMSSTYVEIRRWQDIKNPGSVNQD------PIFKSYSLPPHECGYP-GRVFNPLNFA 175          
BLAST of EY756518 vs. ExPASy Swiss-Prot
Match: CB23_PEA (Chlorophyll a-b binding protein 3, chloroplastic OS=Pisum sativum GN=lhca3 PE=1 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 4.247e-14
Identity = 60/173 (34.68%), Postives = 86/173 (49.71%), Query Frame = 1
Query:  214 PAVKGGGNLINPEW---------LDGSLPGDYGFDPLGLGKDP----AFL--KWYREAELIHGRWAMAAVVGI----FVGQAW-----SGIPWFEAGADPGAIAPFSFG----SLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPL 648
            P VK GG +  P W         LDGSLPGDYGFDPLGL  DP     F+  +W    E+I+GR+AM   VG     ++G+       + + WF+ G  P A   +++     +L   ++ LMG+ E +R+ D+  P S   ++        E     +G   YPGG FF+PL
Sbjct:   46 PPVKQGG-VDRPLWFASKQSLSYLDGSLPGDYGFDPLGL-SDPEGTGGFIEPRWLAYGEVINGRFAMLGAVGAIAPEYLGKVGLIPQETALAWFQTGVIPPA-GTYNYWADNYTLFVLEMALMGFAEHRRFQDWAKPGSMGKQYFL----GLEKGFGGSGNPAYPGGPFFNPL 211          
The following BLAST results are available for this feature:
BLAST of EY756518 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 16
Match NameE-valueIdentityDescription
CB4A_SOLLC3.856e-10182.04Chlorophyll a-b binding protein CP24 10A, chloropl... [more]
CB4B_SOLLC5.509e-10080.19Chlorophyll a-b binding protein CP24 10B, chloropl... [more]
CB4_SPIOL3.880e-9876.89Chlorophyll a-b binding protein CP24, chloroplasti... [more]
CB12_PETHY6.985e-2539.24Chlorophyll a-b binding protein, chloroplastic OS=... [more]
CB12_SOLLC3.467e-2432.06Chlorophyll a-b binding protein 7, chloroplastic O... [more]
CB24_PEA4.685e-2137.65Chlorophyll a-b binding protein P4, chloroplastic ... [more]
CB24_ARATH1.363e-2037.27Chlorophyll a-b binding protein 4, chloroplastic O... [more]
CB4B_ARATH2.660e-1631.34Chlorophyll a-b binding protein CP29.2, chloroplas... [more]
CB120_HORVU5.017e-1533.33Chlorophyll a-b binding protein 1B-20, chloroplast... [more]
CB23_PEA4.247e-1434.68Chlorophyll a-b binding protein 3, chloroplastic O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-009-E07-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756518 ID=EY756518|Name=EY756518|organism=Citrus sinensis|type=EST|length=901bp
CCACGCGTCCGCAGCCCATTCTGCAGCTACAGAAGTCAAGTAGAGATCAT
ATCTATGGCGGCTGCAACATCCGGGGCTGTGTTAAACGGATTGGGTTCTT
CATTCATAAATGGTGGCAAGAAGAGCCAGGCTCTTTTGGCTGGCACGAAT
AGAGTGACAAGTTCTAAAAAGTCAGTTGTTGTAGCTGCTCTTCCACCTAA
AAAATCTTGGATTCCTGCTGTTAAAGGTGGTGGCAACCTCATTAATCCCG
AATGGCTCGATGGCTCTCTCCCAGGTGACTACGGATTCGACCCACTTGGG
CTTGGAAAGGACCCAGCATTCCTGAAATGGTACAGAGAAGCAGAACTGAT
CCACGGACGATGGGCAATGGCTGCAGTTGTTGGGATATTCGTCGGACAGG
CGTGGAGTGGGATTCCATGGTTCGAGGCTGGAGCAGATCCTGGAGCCATA
GCACCCTTCTCCTTCGGCTCACTCCTGGGAACCCAGCTTCTCCTTATGGG
TTGGGTTGAGAGCAAGCGGTGGGTTGATTTTTTCAATCCTGAATCTCAAT
CAGTTGAATGGGCAACACCTTGGTCAAGAACTGCTGAAAACTTTGCCAAT
GCGACTGGTGAACAAGGCTACCCTGGTGGAAAGTTTTTTGATCCCTTATG
TTTGGCTGGAACATTAAGGATGGTGTCTACATTCCTGACACTGAGAAGCT
TGACAGGCTCAAAAGTGCTGAGATTAACATGCTAGGCTTGCTATGGTGGC
CATGNTGATTTTCTACTTTGAAGCTGGCCAAGCAAGACGCCACTTGGGCT
CTTGGTTGTAAACATGCTATGGAGATACTCACTGATGGNNGTAAAGCGAA
TCATCGGATGATATGAGTCCCTCATGAAAGTCATTTGATGGGGTAGTTGG
G
back to top