EY756515

Overview
NameEY756515
Unique NameEY756515
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length717
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7020 contig Csv1_Contig7020:283..1000. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756515 vs. ExPASy Swiss-Prot
Match: YSL1_ARATH (Metal-nicotianamine transporter YSL1 OS=Arabidopsis thaliana GN=YSL1 PE=2 SV=2)

HSP 1 Score: 313.538 bits (802), Expect = 1.933e-85
Identity = 142/186 (76.34%), Postives = 166/186 (89.25%), Query Frame = 1
Query:   13 VAGMVGCGLVKSVVSVACILMQDFKTAHCTYTSPRAMFLNQVIGTAIGCVVAPISFLLFYKAFDVGNPHGEFKAPYALIYRNMAVIGVQGFSALPQHCLQLCYGLFASAVAVNLVRDFSPEKIGKWMPLPMVMALPFLVGAYFAIDMCVGSLVVYLWHKRNPKKAELMIPAVASGLICGEGLWTLP 570
            VAG+ GCGL+KSVVSV+CILMQDFKTAH T TSP+AMF +Q+IGT +GC+V P+SF LFYKAFD+GNP+GEFKAPYALIYRNMA++GVQGFSALP HCLQ+CYG F  AV VN+VRD +P KIG++MPLP  MA+PFLVGAYFAIDMCVG+L+V++W K N KKAE M+PAVASGLICGEGLWTLP
Sbjct:  468 VAGLAGCGLIKSVVSVSCILMQDFKTAHYTMTSPKAMFASQMIGTVVGCIVTPLSFFLFYKAFDIGNPNGEFKAPYALIYRNMAILGVQGFSALPLHCLQMCYGFFGFAVLVNVVRDLTPAKIGRFMPLPTAMAVPFLVGAYFAIDMCVGTLIVFVWEKMNRKKAEFMVPAVASGLICGEGLWTLP 653          

HSP 2 Score: 23.8682 bits (50), Expect = 1.933e-85
Identity = 9/11 (81.82%), Postives = 10/11 (90.91%), Query Frame = 3
Query:  597 QPPICMKFLDS 629
            +PPICMKFL S
Sbjct:  663 KPPICMKFLAS 673          
BLAST of EY756515 vs. ExPASy Swiss-Prot
Match: YSL3_ARATH (Metal-nicotianamine transporter YSL3 OS=Arabidopsis thaliana GN=YSL3 PE=2 SV=1)

HSP 1 Score: 298.901 bits (764), Expect = 1.789e-80
Identity = 137/186 (73.66%), Postives = 161/186 (86.56%), Query Frame = 1
Query:   13 VAGMVGCGLVKSVVSVACILMQDFKTAHCTYTSPRAMFLNQVIGTAIGCVVAPISFLLFYKAFDVGNPHGEFKAPYALIYRNMAVIGVQGFSALPQHCLQLCYGLFASAVAVNLVRDFSPEKIGKWMPLPMVMALPFLVGAYFAIDMCVGSLVVYLWHKRNPKKAELMIPAVASGLICGEGLWTLP 570
            VAG+VGCGL+KS+VS++  LM DFKT H T TSPR+M ++Q IGTAIGCVVAP++F LFYKAFDVGN  GE+KAPYAL+YRNMA++GV+GFSALPQHCLQLCYG FA AVA NLVRD  P+KIG W+PLPM MA+PFLVG YFAIDMCVGSL+V+ W+ R+  KA LM+PAVASGLICG+GLW LP
Sbjct:  466 VAGLVGCGLIKSIVSISSDLMHDFKTGHLTLTSPRSMLVSQAIGTAIGCVVAPLTFFLFYKAFDVGNQEGEYKAPYALVYRNMAILGVEGFSALPQHCLQLCYGFFAFAVAANLVRDRLPDKIGNWVPLPMAMAVPFLVGGYFAIDMCVGSLIVFAWNMRDRVKAGLMVPAVASGLICGDGLWILP 651          
BLAST of EY756515 vs. ExPASy Swiss-Prot
Match: YSL2_ARATH (Metal-nicotianamine transporter YSL2 OS=Arabidopsis thaliana GN=YSL2 PE=2 SV=1)

HSP 1 Score: 293.893 bits (751), Expect = 5.755e-79
Identity = 137/186 (73.66%), Postives = 159/186 (85.48%), Query Frame = 1
Query:   13 VAGMVGCGLVKSVVSVACILMQDFKTAHCTYTSPRAMFLNQVIGTAIGCVVAPISFLLFYKAFDVGNPHGEFKAPYALIYRNMAVIGVQGFSALPQHCLQLCYGLFASAVAVNLVRDFSPEKIGKWMPLPMVMALPFLVGAYFAIDMCVGSLVVYLWHKRNPKKAELMIPAVASGLICGEGLWTLP 570
            VAGMV CGL+KS+VSV+  LM DFKT H T TSPR+M + Q IGTAIGCVVAP++F LFYKAFDVGN +GE+KAPYA+IYRNMA+IGVQG SALP+HCL+LCYG FA AVA NL RD  P+K GKW+PLPM MA+PFLVG  FAIDMC+GSLVVY+W K N KKA++M+PAVASGLICG+GLW LP
Sbjct:  458 VAGMVACGLIKSIVSVSADLMHDFKTGHLTQTSPRSMLVAQAIGTAIGCVVAPLTFFLFYKAFDVGNQNGEYKAPYAMIYRNMAIIGVQGPSALPKHCLELCYGFFAFAVAANLARDLLPDKPGKWIPLPMAMAVPFLVGGSFAIDMCIGSLVVYVWKKVNRKKADVMVPAVASGLICGDGLWILP 643          
BLAST of EY756515 vs. ExPASy Swiss-Prot
Match: YSL16_ORYSJ (Probable metal-nicotianamine transporter YSL16 OS=Oryza sativa subsp. japonica GN=YSL16 PE=2 SV=2)

HSP 1 Score: 282.337 bits (721), Expect = 5.600e-76
Identity = 129/186 (69.35%), Postives = 157/186 (84.41%), Query Frame = 1
Query:   13 VAGMVGCGLVKSVVSVACILMQDFKTAHCTYTSPRAMFLNQVIGTAIGCVVAPISFLLFYKAFDVGNPHGEFKAPYALIYRNMAVIGVQGFSALPQHCLQLCYGLFASAVAVNLVRDFSPEKIGKWMPLPMVMALPFLVGAYFAIDMCVGSLVVYLWHKRNPKKAELMIPAVASGLICGEGLWTLP 570
            VAG+VGCGLVK +V ++  LM DFKT H T TSPR+M + QV+GT +GCVVAP++F LFYKAFDVG+P+G +KAPYALIYRNMA+IGV+GFSALP+HCLQLC G FA AV  NL RDF P + G++MPLPM MA+PFLVGA FAIDMC GSLVV+LWH+ + K+A L++PAVASGLICG+G+WT P
Sbjct:  469 VAGLVGCGLVKQLVLISADLMHDFKTGHLTLTSPRSMLVGQVVGTLMGCVVAPLTFFLFYKAFDVGDPNGYWKAPYALIYRNMAIIGVEGFSALPRHCLQLCAGFFAFAVLANLARDFLPRRYGRYMPLPMAMAVPFLVGASFAIDMCAGSLVVFLWHRFDGKRAALLVPAVASGLICGDGIWTFP 654          

HSP 2 Score: 23.483 bits (49), Expect = 5.600e-76
Identity = 8/13 (61.54%), Postives = 11/13 (84.62%), Query Frame = 3
Query:  585 LGQKQPPICMKFL 623
            L + +PPICMKF+
Sbjct:  660 LAKVKPPICMKFI 672          
BLAST of EY756515 vs. ExPASy Swiss-Prot
Match: YSL9_ORYSJ (Probable metal-nicotianamine transporter YSL9 OS=Oryza sativa subsp. japonica GN=YSL9 PE=2 SV=2)

HSP 1 Score: 282.337 bits (721), Expect = 1.733e-75
Identity = 126/186 (67.74%), Postives = 152/186 (81.72%), Query Frame = 1
Query:   13 VAGMVGCGLVKSVVSVACILMQDFKTAHCTYTSPRAMFLNQVIGTAIGCVVAPISFLLFYKAFDVGNPHGEFKAPYALIYRNMAVIGVQGFSALPQHCLQLCYGLFASAVAVNLVRDFSPEKIGKWMPLPMVMALPFLVGAYFAIDMCVGSLVVYLWHKRNPKKAELMIPAVASGLICGEGLWTLP 570
            VAG+VGCGLVKS+VS++  LM DFKT H T TSPR+M + Q IGT +GCV++P++F LFY AFD+GNP G +KAPYAL+YRNMA++GV+GFSALPQHCLQLCYG F  AVA NL RD  P K G+W+PLPM M +PFLVGA FAIDMC+GSL+V+ WH  +  KA LM+PAVASGLICG+GLW  P
Sbjct:  478 VAGLVGCGLVKSLVSISADLMHDFKTGHLTLTSPRSMIIAQAIGTVMGCVISPLTFFLFYSAFDIGNPEGYWKAPYALVYRNMAILGVEGFSALPQHCLQLCYGFFGFAVAANLTRDLCPPKYGRWVPLPMAMGVPFLVGASFAIDMCIGSLIVFTWHIIDKSKAALMVPAVASGLICGDGLWIFP 663          
BLAST of EY756515 vs. ExPASy Swiss-Prot
Match: YSL2_ORYSJ (Metal-nicotianamine transporter YSL2 OS=Oryza sativa subsp. japonica GN=YSL2 PE=2 SV=2)

HSP 1 Score: 268.085 bits (684), Expect = 1.764e-71
Identity = 119/186 (63.98%), Postives = 153/186 (82.26%), Query Frame = 1
Query:   13 VAGMVGCGLVKSVVSVACILMQDFKTAHCTYTSPRAMFLNQVIGTAIGCVVAPISFLLFYKAFDVGNPHGEFKAPYALIYRNMAVIGVQGFSALPQHCLQLCYGLFASAVAVNLVRDFSPEKIGKWMPLPMVMALPFLVGAYFAIDMCVGSLVVYLWHKRNPKKAELMIPAVASGLICGEGLWTLP 570
            +AG+VGCG+VK +V V+  LM DFKT H T TSPR+M + Q IGTA+GC++AP++FLLFYKAFD+GNP G +KAPYALI+RNMA++GV+GFSALP+HCL+L  G FA +V +NL+RDF P K   ++PLP  MA+PFLVGA FAIDMCVGSL+V+ WHK N K++ L++PAVASG ICG+G+W  P
Sbjct:  468 IAGLVGCGIVKQLVQVSADLMHDFKTGHLTLTSPRSMLVGQAIGTAMGCIIAPLTFLLFYKAFDIGNPDGYWKAPYALIFRNMAILGVEGFSALPKHCLELSAGFFAFSVLINLMRDFLPRKYRDYVPLPTAMAVPFLVGANFAIDMCVGSLIVFAWHKINSKESALLVPAVASGFICGDGIWMFP 653          

HSP 2 Score: 22.7126 bits (47), Expect = 1.764e-71
Identity = 8/12 (66.67%), Postives = 10/12 (83.33%), Query Frame = 3
Query:  585 LGQKQPPICMKF 620
            L + +PPICMKF
Sbjct:  659 LAKVKPPICMKF 670          
BLAST of EY756515 vs. ExPASy Swiss-Prot
Match: YSL12_ORYSJ (Probable metal-nicotianamine transporter YSL12 OS=Oryza sativa subsp. japonica GN=YSL12 PE=2 SV=2)

HSP 1 Score: 245.358 bits (625), Expect = 3.869e-65
Identity = 109/187 (58.29%), Postives = 148/187 (79.14%), Query Frame = 1
Query:   13 VAGMVGCGLVKSVVSVACILMQDFKTAHCTYTSPRAMFLNQVIGTAIGCVVAPISFLLFYKAF-DVGNPHGEFKAPYALIYRNMAVIGVQGFSALPQHCLQLCYGLFASAVAVNLVRDFSPEKIGKWMPLPMVMALPFLVGAYFAIDMCVGSLVVYLWHKRNPKKAELMIPAVASGLICGEGLWTLP 570
            + G+  CG++ S+VS A  LMQDFKT + T  SPR+MF++QVIGTA+GCV+AP  F LFYKAF D+G    E+ APYA++YRNMA++GV GFS+LP+HCL LCY  FA+A+A+NL RD +P K+ +++PLPM MA+PF +G+YFAIDM +G++++++W   N  KAE   PAVASGLICG+G+WTLP
Sbjct:  499 LVGLAACGVMMSIVSTASDLMQDFKTGYLTLASPRSMFVSQVIGTAMGCVIAPCVFWLFYKAFADIGVSGTEYPAPYAIVYRNMAILGVDGFSSLPKHCLTLCYIFFAAAIAINLARDLAPSKVARFIPLPMAMAIPFYIGSYFAIDMFIGTVILFVWEMVNKAKAEAFAPAVASGLICGDGIWTLP 685          

HSP 2 Score: 24.2534 bits (51), Expect = 3.869e-65
Identity = 9/13 (69.23%), Postives = 11/13 (84.62%), Query Frame = 3
Query:  585 LGQKQPPICMKFL 623
            L + +PPICMKFL
Sbjct:  691 LAKVKPPICMKFL 703          
BLAST of EY756515 vs. ExPASy Swiss-Prot
Match: YS1_MAIZE (Iron-phytosiderophore transporter yellow stripe 1 OS=Zea mays GN=YS1 PE=2 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 1.119e-64
Identity = 114/186 (61.29%), Postives = 142/186 (76.34%), Query Frame = 1
Query:   13 VAGMVGCGLVKSVVSVACILMQDFKTAHCTYTSPRAMFLNQVIGTAIGCVVAPISFLLFYKAFDVGNPHGEFKAPYALIYRNMAVIGVQGFSALPQHCLQLCYGLFASAVAVNLVRDFSPEKIGKWMPLPMVMALPFLVGAYFAIDMCVGSLVVYLWHKRNPKKAELMIPAVASGLICGEGLWTLP 570
            +AG+ G  LVK +V  +  LM DFKT H T TSPR++ + Q IGTA+GCVVAP++FLLFY AFD+GNP G +KAPY LIYRNMA++GV+GFS LP+HCL L  G FA A   ++ RD  P K  +++PLPM MA+PFLVG  FAIDMCVGSL V++W K N K+A  M+PAVASGLICG+G+WT P
Sbjct:  476 IAGLAGGTLVKQLVMASADLMHDFKTGHLTMTSPRSLLVAQFIGTAMGCVVAPLTFLLFYNAFDIGNPTGYWKAPYGLIYRNMAILGVEGFSVLPRHCLALSAGFFAFAFVFSVARDVLPRKYARFVPLPMAMAVPFLVGGSFAIDMCVGSLAVFVWEKVNRKEAVFMVPAVASGLICGDGIWTFP 661          

HSP 2 Score: 22.3274 bits (46), Expect = 1.119e-64
Identity = 8/12 (66.67%), Postives = 10/12 (83.33%), Query Frame = 3
Query:  585 LGQKQPPICMKF 620
            L + +PPICMKF
Sbjct:  667 LAKIKPPICMKF 678          
BLAST of EY756515 vs. ExPASy Swiss-Prot
Match: YSL14_ORYSJ (Probable metal-nicotianamine transporter YSL14 OS=Oryza sativa subsp. japonica GN=YSL14 PE=2 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 4.216e-64
Identity = 106/187 (56.68%), Postives = 149/187 (79.68%), Query Frame = 1
Query:   13 VAGMVGCGLVKSVVSVACILMQDFKTAHCTYTSPRAMFLNQVIGTAIGCVVAPISFLLFYKAF-DVGNPHGEFKAPYALIYRNMAVIGVQGFSALPQHCLQLCYGLFASAVAVNLVRDFSPEKIGKWMPLPMVMALPFLVGAYFAIDMCVGSLVVYLWHKRNPKKAELMIPAVASGLICGEGLWTLP 570
            + G+  CG++ S+VS A  LMQDFKT + T  SPR+MF++QVIGT +GCV+AP  F LFYKAF ++G    E+ APYA++YRNMA++GV GF++LP++CL LCY  FA+A+A+NL+RD +P K+ +++PLPM MA+PF +G+YFAIDM +GS+++++W K N  KA+   PAVASGLICG+G+WTLP
Sbjct:  509 LVGLAACGVMMSIVSTASDLMQDFKTGYLTLASPRSMFISQVIGTGMGCVIAPCVFWLFYKAFSNIGTSGTEYPAPYAIVYRNMAILGVDGFNSLPENCLTLCYIFFAAAIAINLIRDLAPHKVSRFIPLPMAMAIPFYIGSYFAIDMFLGSVILFVWEKLNKAKADAFGPAVASGLICGDGIWTLP 695          

HSP 2 Score: 24.2534 bits (51), Expect = 4.216e-64
Identity = 9/13 (69.23%), Postives = 11/13 (84.62%), Query Frame = 3
Query:  585 LGQKQPPICMKFL 623
            L + +PPICMKFL
Sbjct:  701 LAKVKPPICMKFL 713          
BLAST of EY756515 vs. ExPASy Swiss-Prot
Match: YSL15_ORYSJ (Iron-phytosiderophore transporter YSL15 OS=Oryza sativa subsp. japonica GN=YSL15 PE=2 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 4.219e-64
Identity = 112/186 (60.22%), Postives = 144/186 (77.42%), Query Frame = 1
Query:   13 VAGMVGCGLVKSVVSVACILMQDFKTAHCTYTSPRAMFLNQVIGTAIGCVVAPISFLLFYKAFDVGNPHGEFKAPYALIYRNMAVIGVQGFSALPQHCLQLCYGLFASAVAVNLVRDFSPEKIGKWMPLPMVMALPFLVGAYFAIDMCVGSLVVYLWHKRNPKKAELMIPAVASGLICGEGLWTLP 570
            +AG+V   LVK +V V+  LM D KT H T TSPR+M + ++IGT IGC +AP++F+LFY+AFD+GNP G +KAPYALIYRNMA++G++G SALP+HCL L  G FA AV  N+ RD  P +  K +PLP  MA+PFLVGA FAIDMCVGSLV++ W+K N K+A  M+PAVASGL+CG+G+WT P
Sbjct:  466 IAGLVVGTLVKQLVLVSADLMHDLKTGHLTLTSPRSMLVGELIGTGIGCFIAPLTFMLFYRAFDIGNPDGYWKAPYALIYRNMAILGIEGISALPKHCLSLSVGFFAFAVLTNVARDALPARYKKLVPLPTAMAVPFLVGASFAIDMCVGSLVLFAWNKMNKKEAAFMVPAVASGLMCGDGIWTFP 651          

HSP 2 Score: 22.3274 bits (46), Expect = 4.219e-64
Identity = 8/12 (66.67%), Postives = 10/12 (83.33%), Query Frame = 3
Query:  585 LGQKQPPICMKF 620
            L + +PPICMKF
Sbjct:  657 LAKIKPPICMKF 668          
The following BLAST results are available for this feature:
BLAST of EY756515 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 27
Match NameE-valueIdentityDescription
YSL1_ARATH1.933e-8576.34Metal-nicotianamine transporter YSL1 OS=Arabidopsi... [more]
YSL3_ARATH1.789e-8073.66Metal-nicotianamine transporter YSL3 OS=Arabidopsi... [more]
YSL2_ARATH5.755e-7973.66Metal-nicotianamine transporter YSL2 OS=Arabidopsi... [more]
YSL16_ORYSJ5.600e-7669.35Probable metal-nicotianamine transporter YSL16 OS=... [more]
YSL9_ORYSJ1.733e-7567.74Probable metal-nicotianamine transporter YSL9 OS=O... [more]
YSL2_ORYSJ1.764e-7163.98Metal-nicotianamine transporter YSL2 OS=Oryza sati... [more]
YSL12_ORYSJ3.869e-6558.29Probable metal-nicotianamine transporter YSL12 OS=... [more]
YS1_MAIZE1.119e-6461.29Iron-phytosiderophore transporter yellow stripe 1 ... [more]
YSL14_ORYSJ4.216e-6456.68Probable metal-nicotianamine transporter YSL14 OS=... [more]
YSL15_ORYSJ4.219e-6460.22Iron-phytosiderophore transporter YSL15 OS=Oryza s... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-009-E04-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756515 ID=EY756515|Name=EY756515|organism=Citrus sinensis|type=EST|length=717bp
CCACGCGTCCGGGTGGCTGGAATGGTTGGCTGTGGCCTCGTCAAATCTGT
AGTTTCAGTTGCTTGCATTCTTATGCAAGATTTCAAAACGGCACATTGTA
CTTATACCTCTCCGCGAGCAATGTTCCTGAACCAAGTAATTGGCACCGCC
ATTGGCTGCGTGGTGGCTCCTATCAGTTTCCTTCTATTCTACAAGGCATT
TGATGTGGGAAACCCTCATGGAGAGTTTAAGGCTCCTTATGCATTAATCT
ACAGAAACATGGCGGTTATAGGCGTTCAAGGCTTCTCAGCTCTTCCCCAG
CACTGCTTACAGCTTTGTTATGGTTTATTTGCTTCAGCAGTGGCGGTTAA
CCTTGTAAGAGATTTTTCACCGGAAAAGATTGGGAAATGGATGCCGCTGC
CGATGGTGATGGCTCTGCCGTTTCTAGTTGGAGCATACTTTGCTATTGAT
ATGTGTGTTGGGAGTTTGGTTGTCTATCTGTGGCACAAACGGAACCCCAA
GAAGGCCGAGTTGATGATTCCTGCAGTTGCCTCTGGGTTAATTTGTGGGG
AAGGGCTATGGACACTTCCTGCTTCAATTCTTGCCTTGGCCAAAAACAAC
CTCCTATCTGCATGAAATTTTTGGATTCGTAGAAGTAGAGAGGAACCTCT
TTTAAAAATATACATCGCTTATGATTTACCATACGAAATAATGATTCCCA
CTTTTTCNNTTAANNNN
back to top