EY756514

Overview
NameEY756514
Unique NameEY756514
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length939
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7017 contig Csv1_Contig7017:141..1080. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756514 vs. ExPASy Swiss-Prot
Match: KSG9_ARATH (Shaggy-related protein kinase iota OS=Arabidopsis thaliana GN=ASK9 PE=2 SV=1)

HSP 1 Score: 395.971 bits (1016), Expect = 1.665e-109
Identity = 187/196 (95.41%), Postives = 190/196 (96.94%), Query Frame = 1
Query:   13 AYIHTVPGVCHRDVKPQNLLVDPLTHQVKLCDFGSAKVLVKGEANISYICSRYYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPFPPAFYFNR 600
            AYIHTVPGVCHRDVKPQNLLVDPLTHQVKLCDFGSAKVLVKGE NISYICSRYYRAPELIFGATEYT SIDIWSAGCVLAELLLGQPLFPGEN+VDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFF+ELREPNARLPNGRP PP F F +
Sbjct:  183 AYIHTVPGVCHRDVKPQNLLVDPLTHQVKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTASIDIWSAGCVLAELLLGQPLFPGENSVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFNELREPNARLPNGRPLPPLFNFKQ 378          
BLAST of EY756514 vs. ExPASy Swiss-Prot
Match: KSG6_ARATH (Shaggy-related protein kinase zeta OS=Arabidopsis thaliana GN=ASK6 PE=1 SV=2)

HSP 1 Score: 394.815 bits (1013), Expect = 3.709e-109
Identity = 186/196 (94.90%), Postives = 190/196 (96.94%), Query Frame = 1
Query:   13 AYIHTVPGVCHRDVKPQNLLVDPLTHQVKLCDFGSAKVLVKGEANISYICSRYYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPFPPAFYFNR 600
            AYIHT PGVCHRDVKPQNLLVDPLTHQ KLCDFGSAKVLVKGEANISYICSRYYRAPELIFGATEYT+SIDIWSAGCVLAELLLGQPLFPGEN+VDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFF+ELREPNARLPNGRP PP F F +
Sbjct:  185 AYIHTAPGVCHRDVKPQNLLVDPLTHQCKLCDFGSAKVLVKGEANISYICSRYYRAPELIFGATEYTSSIDIWSAGCVLAELLLGQPLFPGENSVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFNELREPNARLPNGRPLPPLFNFKQ 380          
BLAST of EY756514 vs. ExPASy Swiss-Prot
Match: KSG7_ARATH (Shaggy-related protein kinase eta OS=Arabidopsis thaliana GN=ASK7 PE=1 SV=2)

HSP 1 Score: 390.578 bits (1002), Expect = 6.995e-108
Identity = 183/196 (93.37%), Postives = 189/196 (96.43%), Query Frame = 1
Query:   13 AYIHTVPGVCHRDVKPQNLLVDPLTHQVKLCDFGSAKVLVKGEANISYICSRYYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPFPPAFYFNR 600
            AYIH V GVCHRD+KPQNLLVDPLTHQVK+CDFGSAK LVKGEANISYICSR+YRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNP+YTDFRFPQIKAHPWHK+FHKRMPPEAID ASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPFPP F F +
Sbjct:  153 AYIHNVAGVCHRDLKPQNLLVDPLTHQVKICDFGSAKQLVKGEANISYICSRFYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNPHYTDFRFPQIKAHPWHKIFHKRMPPEAIDFASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPFPPLFNFKQ 348          
BLAST of EY756514 vs. ExPASy Swiss-Prot
Match: KSG5_ARATH (Shaggy-related protein kinase epsilon OS=Arabidopsis thaliana GN=ASK5 PE=2 SV=1)

HSP 1 Score: 357.836 bits (917), Expect = 5.067e-101
Identity = 167/197 (84.77%), Postives = 179/197 (90.86%), Query Frame = 1
Query:    4 RVRAYIHTVPGVCHRDVKPQNLLVDPLTHQVKLCDFGSAKVLVKGEANISYICSRYYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPFPPAFYF 594
            R  AYIH   GVCHRD+KPQNLLV+P THQVKLCDFGSAKVLVKGE NISYICSRYYRAPELIFGATEYTT+IDIWSAGCVLAELLLGQPLFPGE+ VDQLVEIIKVLGTPTREEI+CMNPNYT+F+FPQIKAHPWHK+FHKR PPEA+DL SRLLQYSP+LR TA+EA  HPFFDELR+PN RLPNGR  PP F F
Sbjct:  184 RALAYIHGGVGVCHRDIKPQNLLVNPHTHQVKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTTIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKIFHKRTPPEAVDLVSRLLQYSPNLRSTAMEAIVHPFFDELRDPNTRLPNGRALPPLFNF 380          

HSP 2 Score: 31.5722 bits (70), Expect = 5.067e-101
Identity = 14/22 (63.64%), Postives = 17/22 (77.27%), Query Frame = 3
Query:  597 QELAGASPELXHRLIPEHVRRQ 662
            QEL GAS EL  +LIP+H R+Q
Sbjct:  383 QELKGASLELLSKLIPDHARKQ 404          
BLAST of EY756514 vs. ExPASy Swiss-Prot
Match: KSG8_ARATH (Shaggy-related protein kinase theta OS=Arabidopsis thaliana GN=ASK8 PE=2 SV=3)

HSP 1 Score: 356.681 bits (914), Expect = 8.619e-101
Identity = 160/197 (81.22%), Postives = 179/197 (90.86%), Query Frame = 1
Query:    4 RVRAYIHTVPGVCHRDVKPQNLLVDPLTHQVKLCDFGSAKVLVKGEANISYICSRYYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPFPPAFYF 594
            R   Y+H V GVCHRD+KPQNLLV+P THQ+K+CDFGSAK+LV GE NISYICSRYYRAPELIFGATEYT +ID+WS GCV+AELLLGQPLFPGE+ +DQLVEIIK+LGTPTREEIRCMNPNYT+F+FPQIKAHPWHK+FHKRMPPEA+DL SRLLQYSP+LRCTALEACAHPFFD+LR+PN  LPNGR  PP F F
Sbjct:  248 RALNYLHRVVGVCHRDIKPQNLLVNPQTHQLKICDFGSAKMLVPGEPNISYICSRYYRAPELIFGATEYTNAIDMWSGGCVMAELLLGQPLFPGESGIDQLVEIIKILGTPTREEIRCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACAHPFFDDLRDPNVSLPNGRALPPLFNF 444          

HSP 2 Score: 31.9574 bits (71), Expect = 8.619e-101
Identity = 18/26 (69.23%), Postives = 19/26 (73.08%), Query Frame = 3
Query:  597 QELAGASPELXHRLIPEHVRRQTGSS 674
            QELAGAS EL  RLIP H  + TGSS
Sbjct:  447 QELAGASTELRQRLIPAHC-QGTGSS 471          
BLAST of EY756514 vs. ExPASy Swiss-Prot
Match: KSG4_ARATH (Shaggy-related protein kinase delta OS=Arabidopsis thaliana GN=ASK4 PE=2 SV=1)

HSP 1 Score: 354.369 bits (908), Expect = 1.468e-100
Identity = 160/194 (82.47%), Postives = 177/194 (91.24%), Query Frame = 1
Query:   13 AYIHTVPGVCHRDVKPQNLLVDPLTHQVKLCDFGSAKVLVKGEANISYICSRYYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPFPPAFYF 594
            AY+H   G+CHRD+KPQNLLV+P THQ+K+CDFGSAKVLVKGE NISYICSRYYRAPELIFGATEYTT+IDIWS GCV+AELLLGQPLFPGE+ VDQLVEIIKVLGTPTREEI+CMNPNYT+F+FPQIK HPWHKVF KR+PPEA+DL  R  QYSP+LRCTA+EAC HPFFDELR+PNARLPNGRP PP F F
Sbjct:  195 AYLHNCCGLCHRDIKPQNLLVNPHTHQLKICDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSTGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKPHPWHKVFQKRLPPEAVDLLCRFFQYSPNLRCTAVEACIHPFFDELRDPNARLPNGRPLPPLFNF 388          

HSP 2 Score: 33.4982 bits (75), Expect = 1.468e-100
Identity = 15/30 (50.00%), Postives = 18/30 (60.00%), Query Frame = 3
Query:  597 QELAGASPELXHRLIPEHVRRQTGSSMPHS 686
            QEL+G  PE   RL+PEH R+Q      HS
Sbjct:  391 QELSGIPPETVDRLVPEHARKQNHFMALHS 420          
BLAST of EY756514 vs. ExPASy Swiss-Prot
Match: MSK1_TOBAC (Shaggy-related protein kinase NtK-1 OS=Nicotiana tabacum GN=NTK-1 PE=2 SV=1)

HSP 1 Score: 359.377 bits (921), Expect = 5.549e-100
Identity = 168/203 (82.76%), Postives = 182/203 (89.66%), Query Frame = 1
Query:    4 RVRAYIHTVPGVCHRDVKPQNLLVDPLTHQVKLCDFGSAKVLVKGEANISYICSRYYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPFPPAFYFNRN*LE 612
            R  +YIH   GVCHRD+KPQNLLV+P THQVKLCDFGSAKVLVKGE NISYICSRYYRAPELIFGATEYTT+IDIWSAGCVLAELLLGQPLFPGE+ VDQLVEIIKVLGTPTREEI+CMNPNY +F+FPQIKAHPWHK+FHKRMPPEA+DL SRLLQYSP+LRCTALEA  H FFDELR+PN RLPNGR  PP F F  + L+
Sbjct:  183 RALSYIHHTIGVCHRDIKPQNLLVNPHTHQVKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDIWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYNEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEAVTHAFFDELRDPNTRLPNGRVLPPLFNFKAHELK 385          

HSP 2 Score: 26.5646 bits (57), Expect = 5.549e-100
Identity = 12/24 (50.00%), Postives = 15/24 (62.50%), Query Frame = 3
Query:  600 ELAGASPELXHRLIPEHVRRQTGS 671
            EL G S E   +L+PEH R+Q  S
Sbjct:  383 ELKGVSAENLLKLVPEHARKQCPS 406          
BLAST of EY756514 vs. ExPASy Swiss-Prot
Match: KSG10_ARATH (Shaggy-related protein kinase kappa OS=Arabidopsis thaliana GN=ASK10 PE=1 SV=2)

HSP 1 Score: 350.903 bits (899), Expect = 7.239e-100
Identity = 159/197 (80.71%), Postives = 176/197 (89.34%), Query Frame = 1
Query:    4 RVRAYIHTVPGVCHRDVKPQNLLVDPLTHQVKLCDFGSAKVLVKGEANISYICSRYYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPFPPAFYF 594
            R  AYIH   G+CHRD+KPQNLLV+P THQ+K+CDFGSAKVLVKGE N+SYICSRYYRAPELIFGA+EYTT+IDIWS GCV+AELLLGQPLFPGE+ VDQLVEIIKVLGTPTREEI+CMNPNYT+F+FPQIK HPWHKVF KR+PPEA+DL  R  QYSP+LRCTALEAC HP FDELR+PN RLPNGRP PP F F
Sbjct:  193 RALAYIHNSFGLCHRDIKPQNLLVNPHTHQLKICDFGSAKVLVKGEPNVSYICSRYYRAPELIFGASEYTTAIDIWSTGCVMAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKPHPWHKVFQKRLPPEAVDLLCRFFQYSPNLRCTALEACIHPLFDELRDPNTRLPNGRPLPPLFNF 389          

HSP 2 Score: 34.6538 bits (78), Expect = 7.239e-100
Identity = 15/30 (50.00%), Postives = 20/30 (66.67%), Query Frame = 3
Query:  597 QELAGASPELXHRLIPEHVRRQTGSSMPHS 686
            QEL+G  PE+ +RL+PEH R+Q      HS
Sbjct:  392 QELSGIPPEIVNRLVPEHARKQNLFMALHS 421          
BLAST of EY756514 vs. ExPASy Swiss-Prot
Match: KSG3_ARATH (Shaggy-related protein kinase gamma OS=Arabidopsis thaliana GN=ASK3 PE=2 SV=1)

HSP 1 Score: 359.377 bits (921), Expect = 7.240e-100
Identity = 166/197 (84.26%), Postives = 181/197 (91.88%), Query Frame = 1
Query:    4 RVRAYIHTVPGVCHRDVKPQNLLVDPLTHQVKLCDFGSAKVLVKGEANISYICSRYYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPFPPAFYF 594
            R  +YIH   GVCHRD+KPQNLLV+P THQVKLCDFGSAKVLVKGE NISYICSRYYRAPELIFGATEYTT+ID+WSAGCVLAELLLGQPLFPGE+ VDQLVEIIKVLGTPTREEI+CMNPNYT+F+FPQIKAHPWHK+FHKRMPPEA+DL SRLLQYSP+LRC AL++  HPFFDELR+PNARLPNGR  PP F F
Sbjct:  183 RSLSYIHRCIGVCHRDIKPQNLLVNPHTHQVKLCDFGSAKVLVKGEPNISYICSRYYRAPELIFGATEYTTAIDVWSAGCVLAELLLGQPLFPGESGVDQLVEIIKVLGTPTREEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCAALDSLVHPFFDELRDPNARLPNGRFLPPLFNF 379          

HSP 2 Score: 26.1794 bits (56), Expect = 7.240e-100
Identity = 10/21 (47.62%), Postives = 14/21 (66.67%), Query Frame = 3
Query:  600 ELAGASPELXHRLIPEHVRRQ 662
            EL G   E+  +L+PEH R+Q
Sbjct:  383 ELKGVPVEMVAKLVPEHARKQ 403          
BLAST of EY756514 vs. ExPASy Swiss-Prot
Match: KSGT_BRANA (Shaggy-related protein kinase theta OS=Brassica napus PE=2 SV=2)

HSP 1 Score: 352.058 bits (902), Expect = 3.567e-99
Identity = 159/197 (80.71%), Postives = 177/197 (89.85%), Query Frame = 1
Query:    4 RVRAYIHTVPGVCHRDVKPQNLLVDPLTHQVKLCDFGSAKVLVKGEANISYICSRYYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGENAVDQLVEIIKVLGTPTREEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPFPPAFYF 594
            R   Y+H V GVCHRD+KPQNLLV+  THQ+K+CDFGSAK+LV GE NISYICSRYYRAPELIFGATEYT +ID+WS GCV+AELLLGQPLFPGE+ +DQLVEIIK+LGTPTREEIRCMNPNYT+F+FPQIKAHPWHK+FHKRMPPEA+DL SRLLQYSP+LRCTALEACAHPFFD+LR PN  LPNGR  PP F F
Sbjct:  244 RALNYLHRVVGVCHRDIKPQNLLVNTHTHQLKICDFGSAKMLVPGEPNISYICSRYYRAPELIFGATEYTNAIDMWSGGCVMAELLLGQPLFPGESGIDQLVEIIKILGTPTREEIRCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACAHPFFDDLRAPNVSLPNGRALPPLFNF 440          

HSP 2 Score: 31.187 bits (69), Expect = 3.567e-99
Identity = 16/26 (61.54%), Postives = 17/26 (65.38%), Query Frame = 3
Query:  597 QELAGASPELXHRLIPEHVRRQTGSS 674
            QELAGAS EL  RLIP H +    SS
Sbjct:  443 QELAGASTELRQRLIPAHCQGTGNSS 468          
The following BLAST results are available for this feature:
BLAST of EY756514 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
KSG9_ARATH1.665e-10995.41Shaggy-related protein kinase iota OS=Arabidopsis ... [more]
KSG6_ARATH3.709e-10994.90Shaggy-related protein kinase zeta OS=Arabidopsis ... [more]
KSG7_ARATH6.995e-10893.37Shaggy-related protein kinase eta OS=Arabidopsis t... [more]
KSG5_ARATH5.067e-10184.77Shaggy-related protein kinase epsilon OS=Arabidops... [more]
KSG8_ARATH8.619e-10181.22Shaggy-related protein kinase theta OS=Arabidopsis... [more]
KSG4_ARATH1.468e-10082.47Shaggy-related protein kinase delta OS=Arabidopsis... [more]
MSK1_TOBAC5.549e-10082.76Shaggy-related protein kinase NtK-1 OS=Nicotiana t... [more]
KSG10_ARATH7.239e-10080.71Shaggy-related protein kinase kappa OS=Arabidopsis... [more]
KSG3_ARATH7.240e-10084.26Shaggy-related protein kinase gamma OS=Arabidopsis... [more]
KSGT_BRANA3.567e-9980.71Shaggy-related protein kinase theta OS=Brassica na... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-009-E03-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756514 ID=EY756514|Name=EY756514|organism=Citrus sinensis|type=EST|length=939bp
CCACGCGTCCGGGCATATATTCATACAGTTCCTGGGGTCTGCCATAGGGA
TGTGAAGCCTCAAAACCTCTTGGTTGATCCACTCACCCACCAGGTTAAGC
TTTGTGATTTTGGGAGCGCAAAAGTTCTGGTCAAGGGCGAAGCTAATATA
TCGTACATATGCTCTCGATATTACCGAGCTCCAGAACTGATTTTTGGTGC
AACAGAGTATACTACATCGATTGATATTTGGTCAGCTGGTTGTGTTCTTG
CCGAGCTGCTTCTAGGCCAGCCATTATTTCCAGGGGAAAATGCAGTTGAC
CAACTAGTAGAGATTATTAAGGTTCTTGGTACTCCTACTCGGGAAGAAAT
TCGATGCATGAATCCAAATTATACGGATTTTAGATTTCCTCAGATTAAGG
CTCATCCTTGGCACAAGGTTTTCCACAAGCGAATGCCTCCGGAAGCAATT
GACCTTGCATCAAGGCTTCTTCAATATTCACCTAGTCTCCGCTGTACTGC
GCTTGAGGCATGTGCACATCCTTTCTTTGATGAGCTTCGTGAACCTAATG
CCCGCCTTCCAAATGGTCGCCCCTTTCCTCCCGCTTTTTACTTTAACAGG
AATTAGCTGGAGCTTCACCTGAACTGATNCACAGGCTGATACCAGAGCAT
GTGAGGCGGCAAACAGGGTCTAGCATGCCACATTCAGCTGGCACGTAATA
TGGGTGACATGAAACAGTATCAAGAATGGCATTTGGTGGAGGGAAGTGAA
ATGAAGAANCCTTCCTGGGCACATATATTCAACATTTTGGCTTAATTGGT
GGATCTTCGCACGTGCAAAGATGTATGCATATACTGGCTTTTTGCCTNAN
NCCTGAAGNTGATGATTCTGGCTACTATGNCGATCATGCTATTTCCTACT
TTTTTGNACATGGTTTGAGTGCAGGATCCTGAAAGCTAG
back to top