EY756513

Overview
NameEY756513
Unique NameEY756513
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length631
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3300 contig Csv1_Contig3300:178..808. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756513 vs. ExPASy Swiss-Prot
Match: NLTP_MALDO (Non-specific lipid-transfer protein OS=Malus domestica GN=MALD3 PE=1 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 2.138e-36
Identity = 72/114 (63.16%), Postives = 85/114 (74.56%), Query Frame = 1
Query:   58 AALKLVSALVLCMLVTGPLSAQAITCGQVTGSLAPCIVYLRSGGPIPVPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKVR 399
            A  KL   + LCM V+    A AITCGQVT SLAPCI Y+RSGG +P  CCNG+R++N  ARTT DRQTACNCLK  AGSI  +NPNNA GLP  CGV++PYKIS ST+C+ V+
Sbjct:    5 AVTKLALVVALCMAVS---VAHAITCGQVTSSLAPCIGYVRSGGAVPPACCNGIRTINGLARTTADRQTACNCLKNLAGSISGVNPNNAAGLPGKCGVNVPYKISTSTNCATVK 115          
BLAST of EY756513 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUDU (Non-specific lipid-transfer protein 1 OS=Prunus dulcis PE=3 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 2.793e-36
Identity = 69/114 (60.53%), Postives = 88/114 (77.19%), Query Frame = 1
Query:   58 AALKLVSALVLCMLVTGPLSAQAITCGQVTGSLAPCIVYLRSGGPIPVPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKVR 399
            A  KL   + LCM+V+ P+ AQAITCGQV+ +LAPCI Y+R GG +P  CCNG+R++N  ARTTPDRQ ACNCLKQ + S+P +NPNNA  LP  CGV+IPY+IS ST+C+ V+
Sbjct:    5 AMTKLALVVALCMVVSVPI-AQAITCGQVSSNLAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVNIPYQISPSTNCANVK 117          
BLAST of EY756513 vs. ExPASy Swiss-Prot
Match: NLTP_PRUAV (Non-specific lipid-transfer protein OS=Prunus avium PE=1 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 5.267e-35
Identity = 66/114 (57.89%), Postives = 87/114 (76.32%), Query Frame = 1
Query:   58 AALKLVSALVLCMLVTGPLSAQAITCGQVTGSLAPCIVYLRSGGPIPVPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKVR 399
            A  KL   + LCM+V+ P+ AQA+TCGQV+ +LAPCI Y+R GG +P  CCNG+R++N  A+TT DRQTACNCLKQ + S+P +N NNA  LP  CGV++PYKIS ST+C+ V+
Sbjct:    5 AMTKLALVVALCMVVSVPI-AQALTCGQVSSNLAPCIAYVRGGGAVPPACCNGIRNINNLAKTTADRQTACNCLKQLSASVPGVNANNAAALPGKCGVNVPYKISPSTNCATVK 117          
BLAST of EY756513 vs. ExPASy Swiss-Prot
Match: NLTP_PYRCO (Non-specific lipid-transfer protein OS=Pyrus communis PE=1 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 3.774e-33
Identity = 64/114 (56.14%), Postives = 83/114 (72.81%), Query Frame = 1
Query:   58 AALKLVSALVLCMLVTGPLSAQAITCGQVTGSLAPCIVYLRSGGPIPVPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKVR 399
            A +KL   + LCM V+    A AITC QV+ +LAPCI Y+RSGG +P  CCNG++++N  A+TTPDRQ ACNCLK  AGS+  +NP NA  LP  CGV++PYKIS ST+C+ V+
Sbjct:    5 AVIKLALVVALCMAVS---VAHAITCSQVSANLAPCINYVRSGGAVPPACCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKCGVNVPYKISTSTNCATVK 115          
BLAST of EY756513 vs. ExPASy Swiss-Prot
Match: NLTP_HELAN (Non-specific lipid-transfer protein OS=Helianthus annuus PE=3 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 1.098e-32
Identity = 67/113 (59.29%), Postives = 83/113 (73.45%), Query Frame = 1
Query:   61 ALKLVSALVLCMLVTGPLSAQAITCGQVTGSLAPCIVYLRSGGPIPVPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKVR 399
            A+ ++ A V CM+V  P + +A++CGQV+ SLAPCI YL  GG +P  CC+GV+SLN+AA+TTPDRQ AC CLK A  SI  +N  NA   P  CGVSIPYKIS STDCSKV+
Sbjct:    5 AMMVLCAGVTCMVVGAPYT-EALSCGQVSSSLAPCISYLTKGGAVPPACCSGVKSLNSAAKTTPDRQAACGCLKSAYNSISGVNAGNAASFPGKCGVSIPYKISPSTDCSKVQ 116          
BLAST of EY756513 vs. ExPASy Swiss-Prot
Match: NLTP1_PRUAR (Non-specific lipid-transfer protein 1 OS=Prunus armeniaca PE=1 SV=2)

HSP 1 Score: 138.658 bits (348), Expect = 2.447e-32
Identity = 61/91 (67.03%), Postives = 74/91 (81.32%), Query Frame = 1
Query:  127 ITCGQVTGSLAPCIVYLRSGGPIPVPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKVR 399
            ITCGQV+ SLAPCI Y+R GG +P  CCNG+R++N  ARTTPDR+TACNCLKQ +GSI  +NPNNA  LP  CGV+IPYKIS ST+C+ V+
Sbjct:    1 ITCGQVSSSLAPCIGYVRGGGAVPPACCNGIRNVNNLARTTPDRRTACNCLKQLSGSISGVNPNNAAALPGKCGVNIPYKISASTNCATVK 91          
BLAST of EY756513 vs. ExPASy Swiss-Prot
Match: NLTP4_LENCU (Non-specific lipid-transfer protein 4 (Fragment) OS=Lens culinaris PE=1 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 3.195e-32
Identity = 67/107 (62.62%), Postives = 80/107 (74.77%), Query Frame = 1
Query:   82 LVLCMLVTGPLSAQAITCGQVTGSLAPCIVYLRSGGPIPVP-CCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKVR 399
            LV+CM+V  P++  AI+CG VT  L+PC+ YL +GGP P P CC GV+ L AAA TTPDRQ ACNCLK AAGSI  LN NNA  LP  CGV+IPYKIS ST+C+ V+
Sbjct:    4 LVMCMVVIAPMAEGAISCGAVTSDLSPCLTYL-TGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTSTNCNTVK 109          
BLAST of EY756513 vs. ExPASy Swiss-Prot
Match: NLTP6_LENCU (Non-specific lipid-transfer protein 6 OS=Lens culinaris PE=1 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 4.173e-32
Identity = 67/107 (62.62%), Postives = 79/107 (73.83%), Query Frame = 1
Query:   82 LVLCMLVTGPLSAQAITCGQVTGSLAPCIVYLRSGGPIPVP-CCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKVR 399
            LV+CM+V  P++  AI+CG VT  L+PC+ YL +GGP P P CC GV+ L AAA TTPDRQ ACNCLK AAGSI  LN NNA  LP  CGV IPYKIS ST+C+ V+
Sbjct:   12 LVMCMVVIAPMAEGAISCGAVTSDLSPCLTYL-TGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVDIPYKISTSTNCNTVK 117          
BLAST of EY756513 vs. ExPASy Swiss-Prot
Match: NLTP2_LENCU (Non-specific lipid-transfer protein 2 OS=Lens culinaris PE=1 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 7.118e-32
Identity = 66/107 (61.68%), Postives = 80/107 (74.77%), Query Frame = 1
Query:   82 LVLCMLVTGPLSAQAITCGQVTGSLAPCIVYLRSGGPIPVP-CCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKVR 399
            LV+CM+V  P++  AI+CG VT  L+PC+ YL +GGP P P CC GV+ L AAA TTPDRQ ACNCLK AAGSI  LN NNA  LP  CGV+IPYKIS +T+C+ V+
Sbjct:   12 LVICMVVIAPMAEGAISCGAVTSDLSPCLTYL-TGGPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAALPGKCGVNIPYKISTTTNCNTVK 117          
BLAST of EY756513 vs. ExPASy Swiss-Prot
Match: NLTP2_BRANA (Non-specific lipid-transfer protein 2 OS=Brassica napus GN=LTP2 PE=3 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 7.118e-32
Identity = 68/117 (58.12%), Postives = 84/117 (71.79%), Query Frame = 1
Query:   55 MAALKLVSALVL-CMLVTGPLSAQA-ITCGQVTGSLAPCIVYLRSGGPIPVPCCNGVRSLNAAARTTPDRQTACNCLKQAAGSIPNLNPNNAVGLPRACGVSIPYKISISTDCSKVR 399
            MA L  ++ LVL CM+V GP+++ A ++CG V+G +APCI YL   GP+P  CC GV +LN  ARTTPDRQ AC CL  AA S P LN   A GLP+ACGV+IPYKIS ST+C+ VR
Sbjct:    1 MAGLMKLACLVLACMIVAGPITSNAALSCGTVSGYVAPCIGYLTQNGPLPRGCCTGVTNLNNMARTTPDRQQACRCLVGAANSFPTLNAARAAGLPKACGVNIPYKISKSTNCNSVR 117          
The following BLAST results are available for this feature:
BLAST of EY756513 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 77
Match NameE-valueIdentityDescription
NLTP_MALDO2.138e-3663.16Non-specific lipid-transfer protein OS=Malus domes... [more]
NLTP1_PRUDU2.793e-3660.53Non-specific lipid-transfer protein 1 OS=Prunus du... [more]
NLTP_PRUAV5.267e-3557.89Non-specific lipid-transfer protein OS=Prunus aviu... [more]
NLTP_PYRCO3.774e-3356.14Non-specific lipid-transfer protein OS=Pyrus commu... [more]
NLTP_HELAN1.098e-3259.29Non-specific lipid-transfer protein OS=Helianthus ... [more]
NLTP1_PRUAR2.447e-3267.03Non-specific lipid-transfer protein 1 OS=Prunus ar... [more]
NLTP4_LENCU3.195e-3262.62Non-specific lipid-transfer protein 4 (Fragment) O... [more]
NLTP6_LENCU4.173e-3262.62Non-specific lipid-transfer protein 6 OS=Lens culi... [more]
NLTP2_LENCU7.118e-3261.68Non-specific lipid-transfer protein 2 OS=Lens culi... [more]
NLTP2_BRANA7.118e-3258.12Non-specific lipid-transfer protein 2 OS=Brassica ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-009-E02-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756513 ID=EY756513|Name=EY756513|organism=Citrus sinensis|type=EST|length=631bp
CCACGCGTCCGAAAAAAAAGAAAAACAAAAAGAAAATCTCAGGAGAAATC
TCAAATGGCTGCCCTCAAGCTTGTTTCAGCTTTGGTTCTGTGCATGTTGG
TGACTGGTCCCCTGAGTGCTCAGGCCATAACATGTGGGCAGGTGACTGGC
TCATTGGCACCATGCATCGTTTACTTGAGATCGGGCGGCCCTATACCTGT
GCCATGCTGCAACGGCGTCAGGTCTCTCAACGCTGCCGCCAGAACCACAC
CTGACCGCCAAACTGCATGCAACTGCTTGAAGCAAGCCGCCGGATCAATC
CCTAACCTCAACCCTAATAATGCTGTTGGTCTTCCACGAGCTTGTGGAGT
CAGCATTCCTTACAAGATCAGCATCTCCACTGACTGCTCTAAGGTCCGGT
GAACAGGAATCTGGGCTGTTGATTTTCATATTTAAGTTGACGGAGTAGAA
TAAATGTATAATAATAAGGACATTTTTGTGTCCGAATTATGAGTCTCTCT
CTACACTTTGTACTGCGAGTCTCGTTCCCGCCCTCGNTTCATGTTGTGTC
TTATTGTCTTTGCTTTTCATGTCATCGNCAGTTTGTGTCTATTCTGTTTA
TTAAATGAAATCTTGCCTTTGTGTTCAAAAA
back to top