EY756511

Overview
NameEY756511
Unique NameEY756511
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length895
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13417 contig Csv1_Contig13417:44..941. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756511 vs. ExPASy Swiss-Prot
Match: NEP1_NEPGR (Aspartic proteinase nepenthesin-1 OS=Nepenthes gracilis GN=nep1 PE=1 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 4.478e-24
Identity = 76/268 (28.36%), Postives = 118/268 (44.03%), Query Frame = 1
Query:   25 PCTGCVGCSSTVFNSAQSTTFKNLGCQAAQCKQVPNPTCGGGACAFNLTYG-SSTIAANLSQDTISLATDIVPGYTFGCIQKATGNSVPPQXXXXXXXXXXXXXAQTQNLYQSTFSYCLPSFKALSFSGSLRLGPI------GQPKRIKYTPLLKNPRRSSLYYVNLLAIRVGRRVVDIPPGALQFNPTTG-AGTIIDSGTVFTRLVAPAYTAVRDVFRRRVGSNLTVTSLGGFDTCYSGP-----IXAPTITLMFSGMNVTLPQDNF 789
            PCT C   S+ +FN   S++F  L C +  C+ + +PTC    C +   YG  S    ++  +T++  +  +P  TFGC +   G                   +    L  + FSYC+    + S   +L LG +      G P     T L+++ +  + YY+ L  + VG   + I P A   N   G  G IIDSGT  T  V  AY +VR  F  ++   +   S  GFD C+  P     +  PT  + F G ++ LP +N+
Sbjct:  125 PCTQCFNQSTPIFNPQGSSSFSTLPCSSQLCQALSSPTCSNNFCQYTYGYGDGSETQGSMGTETLTFGSVSIPNITFGCGENNQG--FGQGNGAGLVGMGRGPLSLPSQLDVTKFSYCMTPIGS-STPSNLLLGSLANSVTAGSPN----TTLIQSSQIPTFYYITLNGLSVGSTRLPIDPSAFALNSNNGTGGIIIDSGTTLTYFVNNAYQSVRQEFISQINLPVVNGSSSGFDLCFQTPSDPSNLQIPTFVMHFDGGDLELPSENY 385          
BLAST of EY756511 vs. ExPASy Swiss-Prot
Match: NEP2_NEPGR (Aspartic proteinase nepenthesin-2 OS=Nepenthes gracilis GN=nep2 PE=1 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 5.849e-24
Identity = 76/262 (29.01%), Postives = 110/262 (41.98%), Query Frame = 1
Query:   25 PCTGCVGCSSTVFNSAQSTTFKNLGCQAAQCKQVPNPTCGGGACAFNLTYGS-STIAANLSQDTISLATDIVPGYTFGCIQKATGNSVPPQXXXXXXXXXXXXXAQTQNLYQSTFSYCLPSFKALSFSGSLRLGPI--GQPKRIKYTPLLKNPRRSSLYYVNLLAIRVGRRVVDIPPGALQFNPTTGAGTIIDSGTVFTRLVAPAYTAVRDVFRRRVGSNLTVTSLGGFDTCYSGP-----IXAPTITLMFSGMNVTLPQDN 786
            PCT C    + +FN   S++F  L C++  C+ +P+ TC    C +   YG  ST    ++ +T +  T  VP   FGC +   G                   +    L    FSYC+ S+ + S S +L LG    G P+    T L+ +    + YY+ L  I VG   + IP    Q       G IIDSGT  T L   AY AV   F  ++       S  G  TC+  P     +  P I++ F G  + L + N
Sbjct:  126 PCTQCFSQPTPIFNPQDSSSFSTLPCESQYCQDLPSETCNNNECQYTYGYGDGSTTQGYMATETFTFETSSVPNIAFGCGEDNQGFG--QGNGAGLIGMGWGPLSLPSQLGVGQFSYCMTSYGSSSPS-TLALGSAASGVPEGSPSTTLIHSSLNPTYYYITLQGITVGGDNLGIPSSTFQLQDDGTGGMIIDSGTTLTYLPQDAYNAVAQAFTDQINLPTVDESSSGLSTCFQQPSDGSTVQVPEISMQFDGGVLNLGEQN 384          
The following BLAST results are available for this feature:
BLAST of EY756511 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
NEP1_NEPGR4.478e-2428.36Aspartic proteinase nepenthesin-1 OS=Nepenthes gra... [more]
NEP2_NEPGR5.849e-2429.01Aspartic proteinase nepenthesin-2 OS=Nepenthes gra... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-009-D12-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756511 ID=EY756511|Name=EY756511|organism=Citrus sinensis|type=EST|length=895bp
CCACGCGTCCGTGCTGCTTGGGTTCCATGCACTGGCTGTGTTGGCTGCTC
TTCCACCGTTTTTAATTCTGCTCAATCCACCACATTCAAAAACCTTGGTT
GCCAAGCTGCTCAATGCAAGCAGGTACCCAATCCCACCTGCGGGGGTGGC
GCGTGTGCATTCAATTTGACCTACGGCAGCTCCACCATTGCCGCAAACCT
CTCACAGGACACTATCTCCCTGGCCACTGATATAGTCCCTGGTTACACCT
TCGGCTGCATCCAAAAGGCCACGGGCAACTCGGTGCCGCCCCAAGGCCTG
TTGGGCCTGGGTCGTGGCTCATTATCCCTTTTGGCACAAACACAGAACCT
CTATCAGTCCACTTTTTCTTACTGTTTGCCCAGCTTCAAGGCACTTAGCT
TTTCTGGGTCATTAAGATTAGGACCCATTGGTCAGCCCAAGCGGATTAAG
TATACACCATTGCTTAAAAACCCAAGAAGATCATCACTTTACTATGTTAA
TTTGTTGGCCATTAGGGTTGGCAGAAGAGTTGTTGATATCCCACCTGGTG
CCTTACAGTTCAATCCCACAACCGGCGCTGGCACTATTATTGATTCTGGC
ACAGTTTTTACCAGACTGGTGGCGCCAGCTTACACCGCAGTGAGAGACGT
GTTCCGTAGACGCGTAGGGAGTAACTTAACAGTGACATCCCTAGGCGGAT
TCGACACGTGCTACTCGGGTCCAATCNGTGCACCGACAATCACGTTGATG
TTCTCAGGCATGAACGTGACTCTACCACAAGACAACTTCTAATCACAGCA
CTGCAGGGAGCATCACATGCTTGGNCATGGCTGCAGCTCAGACAACGTCA
ACTCAGTGCTTATGTCATTGCCATATGCAGCAACAAACACAGATC
back to top