EY756503

Overview
NameEY756503
Unique NameEY756503
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length798
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2673 contig Csv1_Contig2673:531..1330. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756503 vs. ExPASy Swiss-Prot
Match: CALM_LILLO (Calmodulin OS=Lilium longiflorum PE=2 SV=2)

HSP 1 Score: 298.13 bits (762), Expect = 3.647e-80
Identity = 149/149 (100.00%), Postives = 149/149 (100.00%), Query Frame = 3
Query:   87 MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 533
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:    1 MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          
BLAST of EY756503 vs. ExPASy Swiss-Prot
Match: CALM_EUPCH (Calmodulin OS=Euphorbia characias PE=2 SV=4)

HSP 1 Score: 298.13 bits (762), Expect = 3.647e-80
Identity = 149/149 (100.00%), Postives = 149/149 (100.00%), Query Frame = 3
Query:   87 MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 533
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:    1 MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          
BLAST of EY756503 vs. ExPASy Swiss-Prot
Match: CALM_BRYDI (Calmodulin OS=Bryonia dioica PE=2 SV=2)

HSP 1 Score: 298.13 bits (762), Expect = 3.647e-80
Identity = 149/149 (100.00%), Postives = 149/149 (100.00%), Query Frame = 3
Query:   87 MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 533
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:    1 MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          
BLAST of EY756503 vs. ExPASy Swiss-Prot
Match: CALM7_ARATH (Calmodulin-7 OS=Arabidopsis thaliana GN=CAM7 PE=1 SV=2)

HSP 1 Score: 298.13 bits (762), Expect = 3.647e-80
Identity = 149/149 (100.00%), Postives = 149/149 (100.00%), Query Frame = 3
Query:   87 MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 533
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:    1 MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          
BLAST of EY756503 vs. ExPASy Swiss-Prot
Match: CALM1_PETHY (Calmodulin-1 OS=Petunia hybrida GN=CAM81 PE=2 SV=2)

HSP 1 Score: 298.13 bits (762), Expect = 3.647e-80
Identity = 149/149 (100.00%), Postives = 149/149 (100.00%), Query Frame = 3
Query:   87 MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 533
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:    1 MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          
BLAST of EY756503 vs. ExPASy Swiss-Prot
Match: CALM1_DAUCA (Calmodulin-1/11/16 OS=Daucus carota GN=CAM-1 PE=2 SV=2)

HSP 1 Score: 298.13 bits (762), Expect = 3.647e-80
Identity = 149/149 (100.00%), Postives = 149/149 (100.00%), Query Frame = 3
Query:   87 MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 533
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:    1 MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          
BLAST of EY756503 vs. ExPASy Swiss-Prot
Match: CALM_HORVU (Calmodulin OS=Hordeum vulgare GN=CAM PE=2 SV=2)

HSP 1 Score: 296.975 bits (759), Expect = 8.124e-80
Identity = 148/149 (99.33%), Postives = 149/149 (100.00%), Query Frame = 3
Query:   87 MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 533
            MADQLTDDQI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:    1 MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          
BLAST of EY756503 vs. ExPASy Swiss-Prot
Match: CALM_CAPAN (Calmodulin OS=Capsicum annuum GN=CCM1 PE=2 SV=3)

HSP 1 Score: 296.975 bits (759), Expect = 8.124e-80
Identity = 148/149 (99.33%), Postives = 149/149 (100.00%), Query Frame = 3
Query:   87 MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 533
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINY+EFVKVMMAK
Sbjct:    1 MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYDEFVKVMMAK 149          
BLAST of EY756503 vs. ExPASy Swiss-Prot
Match: CALM2_SOYBN (Calmodulin-2 OS=Glycine max GN=CAM-2 PE=1 SV=2)

HSP 1 Score: 296.975 bits (759), Expect = 8.124e-80
Identity = 148/149 (99.33%), Postives = 149/149 (100.00%), Query Frame = 3
Query:   87 MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 533
            MADQLTDDQI+EFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK
Sbjct:    1 MADQLTDDQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 149          
BLAST of EY756503 vs. ExPASy Swiss-Prot
Match: CALM2_ARATH (Calmodulin-2/3/5 OS=Arabidopsis thaliana GN=CAM2 PE=1 SV=3)

HSP 1 Score: 296.975 bits (759), Expect = 8.124e-80
Identity = 148/149 (99.33%), Postives = 149/149 (100.00%), Query Frame = 3
Query:   87 MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGDGQINYEEFVKVMMAK 533
            MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMI+EADVDGDGQINYEEFVKVMMAK
Sbjct:    1 MADQLTDDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIKEADVDGDGQINYEEFVKVMMAK 149          
The following BLAST results are available for this feature:
BLAST of EY756503 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 479
Match NameE-valueIdentityDescription
CALM_LILLO3.647e-80100.00Calmodulin OS=Lilium longiflorum PE=2 SV=2[more]
CALM_EUPCH3.647e-80100.00Calmodulin OS=Euphorbia characias PE=2 SV=4[more]
CALM_BRYDI3.647e-80100.00Calmodulin OS=Bryonia dioica PE=2 SV=2[more]
CALM7_ARATH3.647e-80100.00Calmodulin-7 OS=Arabidopsis thaliana GN=CAM7 PE=1 ... [more]
CALM1_PETHY3.647e-80100.00Calmodulin-1 OS=Petunia hybrida GN=CAM81 PE=2 SV=2[more]
CALM1_DAUCA3.647e-80100.00Calmodulin-1/11/16 OS=Daucus carota GN=CAM-1 PE=2 ... [more]
CALM_HORVU8.124e-8099.33Calmodulin OS=Hordeum vulgare GN=CAM PE=2 SV=2[more]
CALM_CAPAN8.124e-8099.33Calmodulin OS=Capsicum annuum GN=CCM1 PE=2 SV=3[more]
CALM2_SOYBN8.124e-8099.33Calmodulin-2 OS=Glycine max GN=CAM-2 PE=1 SV=2[more]
CALM2_ARATH8.124e-8099.33Calmodulin-2/3/5 OS=Arabidopsis thaliana GN=CAM2 P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-009-D03-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756503 ID=EY756503|Name=EY756503|organism=Citrus sinensis|type=EST|length=798bp
CCACGCGTCCGAGCTCTTGGATTTTTGTAACGAAAAAAAAAATAAATACC
TATTTCTGAGTTGAAAAAACAAACGGAAGAAGAAAAATGGCGGATCAGCT
CACGGACGATCAGATCTCTGAGTTCAAAGAGGCCTTCAGCTTGTTTGACA
AGGATGGCGACGGTTGCATTACCACCAAGGAGCTTGGCACTGTTATGAGG
TCACTGGGTCAGAACCCCACTGAGGCTGAGCTCCAGGACATGATCAATGA
AGTGGATGCTGATGGCAATGGAACTATTGATTTTCCTGAATTCCTAAACC
TCATGGCCAGGAAGATGAAGGATACCGACTCTGAGGAGGAGCTGAAAGAG
GCCTTCCGGGTTTTCGACAAGGATCAGAATGGTTTCATCTCAGCTGCTGA
GCTGCGCCATGTGATGACAAACCTAGGAGAGAAACTTACTGATGAAGAAG
TTGATGAGATGATAAGGGAAGCTGATGTTGATGGTGATGGCCAGATAAAT
TATGAGGAATTTGTCAAGGTTATGATGGCCAAGTAATGACCCCAACCCAC
CAATACTTATAAAATGGGTTGACTAAATTATAAAGGGATTCCTAGTTTTC
TCTTTTACAATTTTTAATTTGATAGTCATGAGGGTCAGGCTAAAGGAAAG
CATGGTCTTTTAATGGTGATGGGCCTGATGGTGTAGGAAGAAATGTGTCT
CCCTCTCAATATGTCTTGTGACTCGAAAAACTTTTCGGNTTTTATTATTT
TTAGTGGTCTGCTGGTCTATGAAAAAAAAAAAAAAAAAAAAAAAAAAA
back to top