EY756502

Overview
NameEY756502
Unique NameEY756502
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length933
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY756502 vs. ExPASy Swiss-Prot
Match: F3PH_PETHY (Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1)

HSP 1 Score: 249.595 bits (636), Expect = 5.842e-66
Identity = 119/157 (75.80%), Postives = 135/157 (85.99%), Query Frame = 2
Query:  197 MLQNMFTAGTDTSSSTIEWAIAELIRHPKVWAQVQQELDSVVGRDRLVTELDLPQLTYLQAVIKEIFRLHPSTPLSLPRAASESCKINGYDIPKGSTLLVNIWAIARDPNEWADPLEFRPERFLPGGEKYNVDVKGNDYELIPFGCRXENLRWLELG 667
            +L N+F AGTDTSSST+EWAIAELIR+PK+ AQ QQE+D VVGRDRLV ELDL QLTYL+A++KE FRLHPSTPLSLPR ASESC+INGY IPKGSTLL+N+WAIARDPN WADPLEFRPERFLPGGEK  VDV+GND+E+IPFG        + LG
Sbjct:  297 LLLNLFVAGTDTSSSTVEWAIAELIRNPKILAQAQQEIDKVVGRDRLVGELDLAQLTYLEAIVKETFRLHPSTPLSLPRIASESCEINGYFIPKGSTLLLNVWAIARDPNAWADPLEFRPERFLPGGEKPKVDVRGNDFEVIPFGAGRRICAGMNLG 453          

HSP 2 Score: 21.9422 bits (45), Expect = 5.842e-66
Identity = 12/23 (52.17%), Postives = 14/23 (60.87%), Query Frame = 1
Query:  754 DMDEAYGLTLSVLRPWCA-PRAR 819
            +M+EAYGLTL    P    PR R
Sbjct:  482 NMEEAYGLTLQRADPLVVHPRPR 504          
BLAST of EY756502 vs. ExPASy Swiss-Prot
Match: F3PH_ARATH (Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 1.078e-60
Identity = 113/157 (71.97%), Postives = 128/157 (81.53%), Query Frame = 2
Query:  197 MLQNMFTAGTDTSSSTIEWAIAELIRHPKVWAQVQQELDSVVGRDRLVTELDLPQLTYLQAVIKEIFRLHPSTPLSLPRAASESCKINGYDIPKGSTLLVNIWAIARDPNEWADPLEFRPERFLPGGEKYNVDVKGNDYELIPFGCRXENLRWLELG 667
            +L NMFTAGTDTS+ST++WAIAELIRHP +  + Q+ELD VVGRDR V E D+ QL YLQAVIKE FRLHP TPLSLP  ASESC+INGY IPKGSTLL NIWAIARDP++W+DPL F+PERFLPGGEK  VDVKG+D+ELIPFG        L LG
Sbjct:  295 LLLNMFTAGTDTSASTVDWAIAELIRHPDIMVKAQEELDIVVGRDRPVNESDIAQLPYLQAVIKENFRLHPPTPLSLPHIASESCEINGYHIPKGSTLLTNIWAIARDPDQWSDPLAFKPERFLPGGEKSGVDVKGSDFELIPFGAGRRICAGLSLG 451          
BLAST of EY756502 vs. ExPASy Swiss-Prot
Match: C75A7_EUSGR (Flavonoid 3',5'-hydroxylase OS=Eustoma grandiflorum GN=CYP75A7 PE=2 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 2.040e-47
Identity = 86/145 (59.31%), Postives = 113/145 (77.93%), Query Frame = 2
Query:  197 MLQNMFTAGTDTSSSTIEWAIAELIRHPKVWAQVQQELDSVVGRDRLVTELDLPQLTYLQAVIKEIFRLHPSTPLSLPRAASESCKINGYDIPKGSTLLVNIWAIARDPNEWADPLEFRPERFLPGGEKYNVDVKGNDYELIPFG 631
            +L NMFTAGTDTSSS IEWA+AEL+++P +  + Q+E+D V+GRDR   E D+ +L YLQA+ KE FR HPSTPL+LPR AS++C++NG+ IPKG+ L VNIWAI RDP+ W +P EF P+RFL   +   +D +GND+ELIPFG
Sbjct:  298 LLLNMFTAGTDTSSSVIEWALAELLKNPIILRRAQEEMDGVIGRDRRFLEADISKLPYLQAICKEAFRKHPSTPLNLPRIASQACEVNGHYIPKGTRLSVNIWAIGRDPSVWENPNEFNPDRFLE-RKNAKIDPRGNDFELIPFG 441          

HSP 2 Score: 24.2534 bits (51), Expect = 2.040e-47
Identity = 11/27 (40.74%), Postives = 15/27 (55.56%), Query Frame = 3
Query:  633 AXXRICAGLSWGLRMGQLGTATLAHAF 713
            A  RICAG   G+ + +    TL H+F
Sbjct:  442 AGRRICAGTRLGILLVEYILGTLVHSF 468          
BLAST of EY756502 vs. ExPASy Swiss-Prot
Match: C75A5_EUSGR (Flavonoid 3',5'-hydroxylase OS=Eustoma grandiflorum GN=CYP75A5 PE=2 SV=1)

HSP 1 Score: 184.882 bits (468), Expect = 2.659e-47
Identity = 86/145 (59.31%), Postives = 113/145 (77.93%), Query Frame = 2
Query:  197 MLQNMFTAGTDTSSSTIEWAIAELIRHPKVWAQVQQELDSVVGRDRLVTELDLPQLTYLQAVIKEIFRLHPSTPLSLPRAASESCKINGYDIPKGSTLLVNIWAIARDPNEWADPLEFRPERFLPGGEKYNVDVKGNDYELIPFG 631
            +L NMFTAGTDTSSS IEWA+AEL+++P +  + Q+E+D V+GRDR   E D+ +L YLQA+ KE FR HPSTPL+LPR AS++C++NG+ IPKG+ L VNIWAI RDP+ W +P EF P+RFL   +   +D +GND+ELIPFG
Sbjct:  298 LLLNMFTAGTDTSSSVIEWALAELLKNPIILKRAQEEMDGVIGRDRRFLEADISKLPYLQAICKEAFRKHPSTPLNLPRIASQACEVNGHYIPKGTRLSVNIWAIGRDPSLWENPNEFNPDRFLE-RKNAKIDPRGNDFELIPFG 441          

HSP 2 Score: 24.2534 bits (51), Expect = 2.659e-47
Identity = 11/27 (40.74%), Postives = 15/27 (55.56%), Query Frame = 3
Query:  633 AXXRICAGLSWGLRMGQLGTATLAHAF 713
            A  RICAG   G+ + +    TL H+F
Sbjct:  442 AGRRICAGTRLGILLVEYILGTLVHSF 468          
BLAST of EY756502 vs. ExPASy Swiss-Prot
Match: C75A1_PETHY (Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida GN=CYP75A1 PE=2 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 4.517e-47
Identity = 84/145 (57.93%), Postives = 110/145 (75.86%), Query Frame = 2
Query:  197 MLQNMFTAGTDTSSSTIEWAIAELIRHPKVWAQVQQELDSVVGRDRLVTELDLPQLTYLQAVIKEIFRLHPSTPLSLPRAASESCKINGYDIPKGSTLLVNIWAIARDPNEWADPLEFRPERFLPGGEKYNVDVKGNDYELIPFG 631
            +L N+FTAGTDTSSS IEWA+AE++++P +  + Q E+D V+GR+R + E D+P L YL+A+ KE FR HPSTPL+LPR ++E C ++GY IPK + L VNIWAI RDP  W +PLEF PERFL  G    +D +GND+ELIPFG
Sbjct:  294 LLLNLFTAGTDTSSSAIEWALAEMMKNPAILKKAQAEMDQVIGRNRRLLESDIPNLPYLRAICKETFRKHPSTPLNLPRISNEPCIVDGYYIPKNTRLSVNIWAIGRDPQVWENPLEFNPERFL-SGRNSKIDPRGNDFELIPFG 437          

HSP 2 Score: 25.409 bits (54), Expect = 4.517e-47
Identity = 12/27 (44.44%), Postives = 15/27 (55.56%), Query Frame = 3
Query:  633 AXXRICAGLSWGLRMGQLGTATLAHAF 713
            A  RICAG   G+ M +    TL H+F
Sbjct:  438 AGRRICAGTRMGIVMVEYILGTLVHSF 464          
BLAST of EY756502 vs. ExPASy Swiss-Prot
Match: C75A3_PETHY (Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida GN=CYP75A3 PE=2 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 3.760e-46
Identity = 83/145 (57.24%), Postives = 109/145 (75.17%), Query Frame = 2
Query:  197 MLQNMFTAGTDTSSSTIEWAIAELIRHPKVWAQVQQELDSVVGRDRLVTELDLPQLTYLQAVIKEIFRLHPSTPLSLPRAASESCKINGYDIPKGSTLLVNIWAIARDPNEWADPLEFRPERFLPGGEKYNVDVKGNDYELIPFG 631
            +L N+FTAGTDTSSS IEWA+AE++++P +  + Q E+D V+G +R + E D+P L YL+A+ KE FR HPSTPL+LPR ++E C ++GY IPK + L VNIWAI RDP  W +PLEF PERFL  G    +D +GND+ELIPFG
Sbjct:  294 LLLNLFTAGTDTSSSAIEWALAEMMKNPAILKKAQGEMDQVIGNNRRLLESDIPNLPYLRAICKETFRKHPSTPLNLPRISNEPCIVDGYYIPKNTRLSVNIWAIGRDPEVWENPLEFYPERFL-SGRNSKIDPRGNDFELIPFG 437          

HSP 2 Score: 25.409 bits (54), Expect = 3.760e-46
Identity = 12/27 (44.44%), Postives = 15/27 (55.56%), Query Frame = 3
Query:  633 AXXRICAGLSWGLRMGQLGTATLAHAF 713
            A  RICAG   G+ M +    TL H+F
Sbjct:  438 AGRRICAGTRMGIVMVEYILGTLVHSF 464          
BLAST of EY756502 vs. ExPASy Swiss-Prot
Match: C98A1_SORBI (Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 6.347e-45
Identity = 82/145 (56.55%), Postives = 113/145 (77.93%), Query Frame = 2
Query:  197 MLQNMFTAGTDTSSSTIEWAIAELIRHPKVWAQVQQELDSVVGRDRLVTELDLPQLTYLQAVIKEIFRLHPSTPLSLPRAASESCKINGYDIPKGSTLLVNIWAIARDPNEWADPLEFRPERFLPGGEKYNVDVKGNDYELIPFG 631
            +L +M TAG DT+  ++EWA+AEL+R+P+V  ++Q+ELD VVGRDR++ E D   L YLQAV+KE  RLHP TPL LP  AS + KI GYDIPKG+ ++VN+WA+ARDP  W++PLE+RPERFL    + N+D+KG+D+ ++PFG
Sbjct:  295 LLWDMITAGMDTTVISVEWAMAELVRNPRVQKKLQEELDRVVGRDRVMLETDFQNLPYLQAVVKESLRLHPPTPLMLPHKASTNVKIGGYDIPKGANVMVNVWAVARDPKVWSNPLEYRPERFL----EENIDIKGSDFRVLPFG 435          
BLAST of EY756502 vs. ExPASy Swiss-Prot
Match: C75A2_SOLME (Flavonoid 3',5'-hydroxylase OS=Solanum melongena GN=CYP75A2 PE=2 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 2.412e-44
Identity = 81/145 (55.86%), Postives = 112/145 (77.24%), Query Frame = 2
Query:  197 MLQNMFTAGTDTSSSTIEWAIAELIRHPKVWAQVQQELDSVVGRDRLVTELDLPQLTYLQAVIKEIFRLHPSTPLSLPRAASESCKINGYDIPKGSTLLVNIWAIARDPNEWADPLEFRPERFLPGGEKYNVDVKGNDYELIPFG 631
            +L N+FTAGTDTSSS IEWA+ E++++P ++ + QQE+D ++G++R   E D+P L YL+A+ KE FR HPSTPL+LPR +S++C I+GY IPK + L VNIWAI RDP+ W +PLEF PERFL   +   ++ +GND+ELIPFG
Sbjct:  297 LLLNLFTAGTDTSSSVIEWALTEMMKNPTIFKKAQQEMDQIIGKNRRFIESDIPNLPYLRAICKEAFRKHPSTPLNLPRVSSDACTIDGYYIPKNTRLSVNIWAIGRDPDVWENPLEFIPERFL-SEKNAKIEHRGNDFELIPFG 440          
BLAST of EY756502 vs. ExPASy Swiss-Prot
Match: C98A2_SOYBN (Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=2 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 5.373e-44
Identity = 93/188 (49.47%), Postives = 126/188 (67.02%), Query Frame = 2
Query:  197 MLQNMFTAGTDTSSSTIEWAIAELIRHPKVWAQVQQELDSVVGRDRLVTELDLPQLTYLQAVIKEIFRLHPSTPLSLPRAASESCKINGYDIPKGSTLLVNIWAIARDPNEWADPLEFRPERFLPGGEKYNVDVKGNDYELIPFGCRXENLRWLELG--PADGSTGDCNIGPCFLXGSCPXGLKPEKL 754
            +L +M TAG DT++ ++EWA+AELIR+P+V  +VQ+ELD V+G +R++TE D   L YLQ V KE  RLHP TPL LP  A+ + K+ GYDIPKGS + VN+WA+ARDP  W DPLEFRPERFL    + +VD+KG+D+ L+PFG         +LG   A    G      C+   + P G+KPE++
Sbjct:  293 LLWDMITAGMDTTAISVEWAMAELIRNPRVQQKVQEELDRVIGLERVMTEADFSNLPYLQCVTKEAMRLHPPTPLMLPHRANANVKVGGYDIPKGSNVHVNVWAVARDPAVWKDPLEFRPERFL----EEDVDMKGHDFRLLPFGSGRRVCPGAQLGINLAASMLGHLLHHFCW---TPPEGMKPEEI 473          
BLAST of EY756502 vs. ExPASy Swiss-Prot
Match: C75A6_CAMME (Flavonoid 3',5'-hydroxylase OS=Campanula medium GN=CYP75A6 PE=2 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 5.757e-44
Identity = 79/146 (54.11%), Postives = 112/146 (76.71%), Query Frame = 2
Query:  197 MLQNMFTAGTDTSSSTIEWAIAELIRHPKVWAQVQQELDSVVGRDRLVTELDLPQLTYLQAVIKEIFRLHPSTPLSLPRAASESCKINGYDIPKGSTLLVNIWAIARDPNEWADPLEFRPERFLPGGEKY-NVDVKGNDYELIPFG 631
            +L ++FTAGTDTSSS IEWA+AE++ H ++  +  +E+D V+GR+R + + D+P L Y QA+ KE FR HPSTPL+LPR ++E+C+++G+ IPK + L+VNIWAI RDP  W +PL+F PERFL   EK+  +D +GN +ELIPFG
Sbjct:  311 LLLDLFTAGTDTSSSVIEWALAEMLNHRQILNRAHEEMDQVIGRNRRLEQSDIPNLPYFQAICKETFRKHPSTPLNLPRISTEACEVDGFHIPKNTRLIVNIWAIGRDPKVWENPLDFTPERFL--SEKHAKIDPRGNHFELIPFG 454          

HSP 2 Score: 22.7126 bits (47), Expect = 5.757e-44
Identity = 11/27 (40.74%), Postives = 13/27 (48.15%), Query Frame = 3
Query:  633 AXXRICAGLSWGLRMGQLGTATLAHAF 713
            A  RICAG   G    +    TL H+F
Sbjct:  455 AGRRICAGARMGAASVEYILGTLVHSF 481          
The following BLAST results are available for this feature:
BLAST of EY756502 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
F3PH_PETHY5.842e-6675.80Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=C... [more]
F3PH_ARATH1.078e-6071.97Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana... [more]
C75A7_EUSGR2.040e-4759.31Flavonoid 3',5'-hydroxylase OS=Eustoma grandifloru... [more]
C75A5_EUSGR2.659e-4759.31Flavonoid 3',5'-hydroxylase OS=Eustoma grandifloru... [more]
C75A1_PETHY4.517e-4757.93Flavonoid 3',5'-hydroxylase 1 OS=Petunia hybrida G... [more]
C75A3_PETHY3.760e-4657.24Flavonoid 3',5'-hydroxylase 2 OS=Petunia hybrida G... [more]
C98A1_SORBI6.347e-4556.55Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1... [more]
C75A2_SOLME2.412e-4455.86Flavonoid 3',5'-hydroxylase OS=Solanum melongena G... [more]
C98A2_SOYBN5.373e-4449.47Cytochrome P450 98A2 OS=Glycine max GN=CYP98A2 PE=... [more]
C75A6_CAMME5.757e-4454.11Flavonoid 3',5'-hydroxylase OS=Campanula medium GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-009-D02-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756502 ID=EY756502|Name=EY756502|organism=Citrus sinensis|type=EST|length=933bp
CCACGCGTCCGATCCTATATTGATTAATTAAAGATAATGATTTCACCATA
ATCTCTCCCTATGAGTAGAGAAGTACTCTTTTCTTGTTAATTTATTATTC
TAATTACAAGGTAATTTCATAAGTGCTCTGTTTATTAGGTCAGATATTTC
TCTTTTCTTTGTTGTGAGAGCTTTATGAATTATATGACGTGTTATCATGC
TGCAGAACATGTTCACAGCAGGCACCGACACGTCATCAAGTACTATAGAA
TGGGCCATTGCAGAGCTCATCCGGCATCCCAAAGTCTGGGCCCAAGTCCA
ACAAGAGCTGGATTCAGTTGTTGGCCGAGATCGACTGGTCACCGAATTGG
ACCTACCTCAGCTCACTTATCTTCAAGCCGTGATCAAGGAAATCTTCCGG
CTCCACCCATCAACACCACTCTCGCTACCGCGAGCAGCTTCCGAAAGTTG
CAAGATCAATGGATACGATATTCCGAAGGGCTCCACACTCTTGGTCAACA
TATGGGCCATTGCACGTGATCCGAATGAATGGGCCGACCCGCTGGAGTTC
CGGCCGGAAAGGTTTTTACCCGGGGGAGAAAAATACAACGTTGATGTTAA
GGGAAATGATTATGAGCTAATACCATTTGGNTGCCGNAANGAGAATTTGC
GCTGGCTTGAGTTGGGGCCTGCGGATGGGTCAACTGGGGACTGCAACATT
GGCCCATGCTTTTTATTNGGGAGCTGCCCGGNTGGNCTGAAGCCNGAAAA
ACTGACATGGACGAAGCTTACGGGCTGACCTTAAGCGTGCTGCGCCCTTG
GTGTGCACCCAGGGCCCGGNTGTCCCCAATGCTTATCCAGCTTAAAGTGG
AGAAATTAAGGCGCGNTTGTTATTGNTCTGATTTTATTTTTTGAAATAAA
TAGGGTTTAAAAAAAAAAAAAAAAGGGCGCCCT
back to top