EY756501

Overview
NameEY756501
Unique NameEY756501
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length913
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7982 contig Csv1_Contig7982:39..952. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756501 vs. ExPASy Swiss-Prot
Match: BI1L_ARATH (BI1-like protein OS=Arabidopsis thaliana GN=At4g15470 PE=2 SV=1)

HSP 1 Score: 305.064 bits (780), Expect = 3.703e-82
Identity = 162/254 (63.78%), Postives = 183/254 (72.05%), Query Frame = 3
Query:   39 KMLGYEGVR----SKDDGKFEVDLEGGDGER-LYPGLSYGENQLRWGFIRKVYGILTAQIVLTTLVSSITVLYNPINDXXXXXXXXXXXXXXXXXXXXXXXHVYHQKHPVNLIVLGLFTVSLSLPVAVSCANTDGRIVLEALILTSAVVCSLTGYTFWASKKGKDFSFLGPXXXXXXXXXXXXXXMQMFFPLGSTSTAVYGGISALVFCGYIVYDTDNLIKRFTYDDYILASVTLYLDILNLFISILRVLRSSD 785
            K  GY  V      +  GK ++DLE G GE  LYPGLSYGENQLRWGFIRKVYGIL+AQ++LTTL+S++ VL  P+ND                       H+YHQKHPVNLI+L LFTVSLS  V VSCA T+GRIVL+ALILT +VV SLT YTFWA+KKGKDFSFLGP              +QMFFPLG TS AVYGG SALVFCGYIVYDTDNLIKRFTYD+YILASV LYLDILNLF++ILR+LR  D
Sbjct:    3 KPYGYASVSMSGIDRSAGK-DIDLEMGVGEATLYPGLSYGENQLRWGFIRKVYGILSAQLLLTTLISAVVVLNPPVNDLLTGSPGILLFLCIVPFILIWPLHIYHQKHPVNLILLALFTVSLSFTVGVSCAMTEGRIVLQALILTLSVVGSLTAYTFWAAKKGKDFSFLGPILFTSLIILVVTSFIQMFFPLGPTSVAVYGGFSALVFCGYIVYDTDNLIKRFTYDEYILASVALYLDILNLFLTILRILRQGD 255          
BLAST of EY756501 vs. ExPASy Swiss-Prot
Match: TMBI4_MOUSE (Transmembrane BAX inhibitor motif-containing protein 4 OS=Mus musculus GN=Tmbim4 PE=2 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 3.764e-26
Identity = 66/209 (31.58%), Postives = 112/209 (53.59%), Query Frame = 3
Query:  153 LRWGFIRKVYGILTAQIVLTTLVSSITVLYNPINDXXXXXXXXXXXXXXXXXXXXXXXHVYHQKHPVNLIVLGLFTVSLSLPVAVSCANTDGRIVLEALILTSAVVCSLTGYTFWASKKGKDFSFLGPXXXXXXXXXXXXXXMQMFFPLGSTSTAVYGGISALVFCGYIVYDTDNLIKRFTYDDYILASVTLYLDILNLFISILRVLRS 779
            +R  F+RKVY IL+ Q++LTT+ S++ + +  +                          ++   HP+NL +L  FT+S SL VA      D  +VL+A I+T+AV   LT YT  + +   DF+  G               +++FF    T   V   + AL+FCG+I+YDT +L+ R + ++Y++A+++LY+DI+NLF+ +L+ L +
Sbjct:   30 IRMAFLRKVYSILSLQVLLTTVTSALFLYFQALRTFVHESPALIVVFALGSLGLIFALTLHRHTHPLNLYLLFAFTLSESLAVAAVVTFYDVYLVLQAFIMTTAVFLGLTAYTLQSKR---DFTKFGAGLFAGLWILCLAGFLKLFF-YSETMELVLASLGALLFCGFIIYDTHSLMHRLSPEEYVIAAISLYMDIINLFLHLLKFLEA 234          
BLAST of EY756501 vs. ExPASy Swiss-Prot
Match: TMBI4_HUMAN (Transmembrane BAX inhibitor motif-containing protein 4 OS=Homo sapiens GN=TMBIM4 PE=1 SV=2)

HSP 1 Score: 112.849 bits (281), Expect = 2.697e-24
Identity = 68/209 (32.54%), Postives = 108/209 (51.67%), Query Frame = 3
Query:  153 LRWGFIRKVYGILTAQIVLTTLVSSITVLYNPINDXXXXXXXXXXXXXXXXXXXXXXXHVYHQKHPVNLIVLGLFTVSLSLPVAVSCANTDGRIVLEALILTSAVVCSLTGYTFWASKKGKDFSFLGPXXXXXXXXXXXXXXMQMFFPLGSTSTAVYGGISALVFCGYIVYDTDNLIKRFTYDDYILASVTLYLDILNLFISILRVLRS 779
            +R  F+RKVY IL+ Q++LTT+ S++ + +  +                          +   K+P+NL +L  FT+  +L VAV     D  I+L+A ILT+ V   LT YT  + K   DFS  G               ++ FF        V     AL+FCG+I+YDT +L+ + + ++Y+LA+++LYLDI+NLF+ +LR L +
Sbjct:   30 IRMAFLRKVYSILSLQVLLTTVTSTVFLYFESVRTFVHESPALILLFALGSLGLIFALTLNRHKYPLNLYLLFGFTLLEALTVAVVVTFYDVYIILQAFILTTTVFFGLTVYTLQSKK---DFSKFGAGLFALLWILCLSGFLKFFF-YSEIMELVLAAAGALLFCGFIIYDTHSLMHKLSPEEYVLAAISLYLDIINLFLHLLRFLEA 234          
BLAST of EY756501 vs. ExPASy Swiss-Prot
Match: YQE4_SCHPO (Uncharacterized membrane protein C576.04 OS=Schizosaccharomyces pombe GN=SPCC576.04 PE=2 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 5.625e-22
Identity = 66/207 (31.88%), Postives = 100/207 (48.31%), Query Frame = 3
Query:  153 LRWGFIRKVYGILTAQIVLTTLVSSITVLYNPINDXXXXXXXXXXXXXXXXXXXXXXXHVYHQKHPVNLIVLGLFTVSLSLPVAVSCANTDGRIVLEALILTSAVVCSLTGYTFWASKKGKDFSFLGPXXXXXXXXXXXXXXMQMFFPLGSTSTAVYGGISALVFCGYIVYDTDNLIKRFTYDDYILASVTLYLDILNLFISILRVL 773
            +R  F+RKVY ILTAQ+ +T+L   I  L+   +                         +    +P N I L LFT    L +  +      RI+LEA+ +T  V  +LT +TF +     DFS LG               +  F P        + G   LVFCGYI++DT N++ R++ +++I++S+ LYLD +NLFI IL++L
Sbjct:   54 IRMAFLRKVYAILTAQLFVTSLFGGIFYLHPAFSFWVQMHPWFLILNFFISLVVLFGLIMKPYSYPRNYIFLFLFTALEGLTLGTAITFFSARIILEAVFITLGVFVALTAFTFQSKW---DFSRLGGFLYVSLWSLILTPLIFFFVPSTPFIDMAFAGFGTLVFCGYILFDTYNILHRYSPEEFIMSSLMLYLDFINLFIRILQIL 257          
BLAST of EY756501 vs. ExPASy Swiss-Prot
Match: TMBI4_CAEEL (Transmembrane BAX inhibitor motif-containing protein 4 OS=Caenorhabditis elegans GN=tmbi-4 PE=2 SV=2)

HSP 1 Score: 90.5077 bits (223), Expect = 1.434e-17
Identity = 64/227 (28.19%), Postives = 103/227 (45.37%), Query Frame = 3
Query:  108 DGERLYPG-LSYGENQLRWGFIRKVYGILTAQIVLTTLVSSITVLYNPINDXXXXXXXXXXXXXXXXXXXXXXXHVYHQKHPVNLIVLGLFTVSLSLPVAVSCANTDGRIVLEALILTSAVVCSLTGYTFWASKKGKDFSFLGPXXXXXXXXXXXXXXMQMFFPLGSTSTAVYGGISALVFCGYIVYDTDNLIKRFTYDDYILASVTLYLDILNLFISILRVLRSSD 785
            D + + PG +      +R  F+RKV GI+  Q++ T  + +        N                        HVY ++ P+N ++L  FT   ++ +       + ++VLEA ++T  VV SL  YT    +  +DFS                   QMFF +      V     A +FC  +V D D ++ RF+ +DYI A V+LY+DILNLFI IL+++  ++
Sbjct:   53 DADGILPGCVGKANRMIRIAFLRKVLGIVGFQLLFTIGICAAIYNIPNSNQLLQKHAWIVFPNLLGSIALIIALHVYAREVPLNYVLLAAFTAVQAVTMGCVVTLFEAKVVLEAAVITGLVVASLFAYTL---QNKRDFSVGYASMGSLLCVLLWAGIFQMFF-MSPAVNFVINVFGAGLFCVLLVIDLDMIMYRFSPEDYICACVSLYMDILNLFIRILQIVAEAN 275          
BLAST of EY756501 vs. ExPASy Swiss-Prot
Match: Y236_CAMJE (Uncharacterized protein Cj0236c OS=Campylobacter jejuni GN=Cj0236c PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.535e-11
Identity = 47/149 (31.54%), Postives = 76/149 (51.01%), Query Frame = 3
Query:  348 PVNLIVLGLFTVSLSLP-----VAVSCANTDGRIVLEALILTSAVVCSLTGYTFWASKKGKDFSFLGPXXXXXXXXXXXXXXMQMFFPLGSTSTAVYGGISALVFCGYIVYDTDNLIKRFTYDDYILASVTLYLDILNLFISILRVLRS 779
            P+NL++L  FT    L      ++V      G I+ +A  LT+    +  G + +A    KDF+ +G               + +FF     + A+   ++A++F  YI+YDT N+I R  Y+  I  +V LYLD +NLF+S+L +LRS
Sbjct:   84 PLNLVLLFGFTFCSGLTLTPLLISVLALPAGGIIIAQAFALTTV---AFAGLSVFAMNTKKDFTVMGKALFIVLIVIVAASLLNLFFQSSIVNLAI-SAVAAILFSFYILYDTQNII-RGNYETPIEGAVALYLDFVNLFVSLLNILRS 227          
The following BLAST results are available for this feature:
BLAST of EY756501 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
BI1L_ARATH3.703e-8263.78BI1-like protein OS=Arabidopsis thaliana GN=At4g15... [more]
TMBI4_MOUSE3.764e-2631.58Transmembrane BAX inhibitor motif-containing prote... [more]
TMBI4_HUMAN2.697e-2432.54Transmembrane BAX inhibitor motif-containing prote... [more]
YQE4_SCHPO5.625e-2231.88Uncharacterized membrane protein C576.04 OS=Schizo... [more]
TMBI4_CAEEL1.434e-1728.19Transmembrane BAX inhibitor motif-containing prote... [more]
Y236_CAMJE1.535e-1131.54Uncharacterized protein Cj0236c OS=Campylobacter j... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-009-C12-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756501 ID=EY756501|Name=EY756501|organism=Citrus sinensis|type=EST|length=913bp
CCACGCGTCCGCGAAAATTCTACCTCAAAATCGCTTGAAAGATGTTGGGC
TACGAGGGCGTGAGGAGCAAAGATGACGGCAAATTCGAGGTAGATCTGGA
AGGCGGAGATGGGGAGAGGCTTTATCCCGGTCTCAGCTACGGCGAGAACC
AGCTCCGATGGGGTTTCATTCGCAAGGTGTACGGCATTTTGACGGCCCAG
ATCGTTTTGACCACCTTGGTCTCCTCAATCACCGTTCTTTACAATCCCAT
CAACGATCTTCTCAGGGGCAATTCTGGCCTTCTCCTCTTCCTTTCCATCC
TCCCCTTCATCCTGTTATGGCCACTGCATGTGTATCATCAGAAGCACCCT
GTGAACTTGATTGTCCTTGGTCTCTTCACTGTATCTCTGAGTCTTCCTGT
TGCTGTAAGCTGCGCTAATACTGATGGTAGGATTGTGCTTGAAGCATTAA
TTCTGACCTCGGCTGTGGTTTGTTCTTTAACTGGGTACACTTTCTGGGCC
TCTAAGAAGGGCAAAGATTTCAGCTTTCTTGGACCAATTCTATTCACCAG
CCTCATAATCCTCATTCTGACTAGCTTTATGCAGATGTTCTTTCCTCTGG
GATCTACGTCCACTGCTGTTTATGGTGGAATTAGTGCACTGGTCTTCTGT
GGATACATCGTTTACGACACTGACAACTTGATCAAGCGCTTCACATATGA
TGATTATATTTTGGCCTCTGTCACTCTCTATCTGGATATTCTGAACCTTT
TCATCTCCATTTTGCGGGTGCTGAGATCATCAGATGGTTAGTTGTACAGT
GGTCTACCACAGACGTAAATCTTTGTGGAATCACCTTATGGTGCTCAGTT
TGTGTTGGCTACACCTGAAACTAGTCTGAAACAATGTATTGAGATATATA
CATCCTCTGATCT
back to top