EY756499

Overview
NameEY756499
Unique NameEY756499
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length894
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig11169 contig Csv1_Contig11169:1359..2251. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756499 vs. ExPASy Swiss-Prot
Match: MTHR1_ARATH (Methylenetetrahydrofolate reductase 1 OS=Arabidopsis thaliana GN=MTHFR1 PE=1 SV=1)

HSP 1 Score: 331.257 bits (848), Expect = 4.671e-90
Identity = 153/191 (80.10%), Postives = 173/191 (90.58%), Query Frame = 3
Query:   12 CLGKLRSSPWSELDGLQPETKIINEQLGKINVKGFLTINSQPAVNGERSDSSSVGWGGPGGYVYQKAYLEFFCSPEKLTALVDKSKALPFITFMAVNKEGNWKANVNQTDVNAVTWGVFPAKEIIQPTVVDPASFKVWKDEAFEIWSRSWASLYPEGDSSRKLLEEVQSSYYLVSLVDNDYINGDLFTVFA 584
            C+G L+SSPWSELDGLQPETKIINEQLGKIN  GFLTINSQP+VN  +SDS ++GWGGPGGYVYQKAYLEFFCS +KL  LV+KSKA P IT+MAVNK  NW +N  ++DVNAVTWGVFPAKE+IQPT+VDPASFKVWKDEAFEIWSRSWA+LYPE D SRKLLEEV++SYYLVSLVDN+YINGD+F+VFA
Sbjct:  402 CIGNLKSSPWSELDGLQPETKIINEQLGKINSNGFLTINSQPSVNAAKSDSPAIGWGGPGGYVYQKAYLEFFCSKDKLDTLVEKSKAFPSITYMAVNKSENWVSNTGESDVNAVTWGVFPAKEVIQPTIVDPASFKVWKDEAFEIWSRSWANLYPEDDPSRKLLEEVKNSYYLVSLVDNNYINGDIFSVFA 592          
BLAST of EY756499 vs. ExPASy Swiss-Prot
Match: MTHR2_ARATH (Methylenetetrahydrofolate reductase 2 OS=Arabidopsis thaliana GN=MTHFR2 PE=1 SV=2)

HSP 1 Score: 325.865 bits (834), Expect = 1.962e-88
Identity = 155/193 (80.31%), Postives = 170/193 (88.08%), Query Frame = 3
Query:   12 CLGKLRSSPWSELDGLQPETKIINEQLGKINVKGFLTINSQPAVNGERSDSSSVGWGGPGGYVYQKAYLEFFCSPEKLTALVDKSKALPFITFMAVNKEGNWKANVNQTDVNAVTWGVFPAKEIIQPTVVDPASFKVWKDEAFEIWSRSWASLYPEGDSSRKLLEEVQSSYYLVSLVDNDYINGDLFTVFADL 590
            CLG L+SSPWSELDGLQPET+IINEQL K+N KGFLTINSQP+VN ERSDS +VGWGGP GYVYQKAYLEFFCS EKL A+V+K KALP IT+MAVNK   W +N  Q DVNAVTWGVFPAKEIIQPT+VDPASF VWKDEAFE WSRSWA+LYPE D SR LLEEV++SYYLVSLV+NDYINGD+F VFADL
Sbjct:  402 CLGNLKSSPWSELDGLQPETRIINEQLIKVNSKGFLTINSQPSVNAERSDSPTVGWGGPVGYVYQKAYLEFFCSKEKLDAVVEKCKALPSITYMAVNKGEQWVSNTAQADVNAVTWGVFPAKEIIQPTIVDPASFNVWKDEAFETWSRSWANLYPEADPSRNLLEEVKNSYYLVSLVENDYINGDIFAVFADL 594          
BLAST of EY756499 vs. ExPASy Swiss-Prot
Match: MTHR_ORYSJ (Probable methylenetetrahydrofolate reductase OS=Oryza sativa subsp. japonica GN=Os03g0815200 PE=2 SV=1)

HSP 1 Score: 312.768 bits (800), Expect = 1.719e-84
Identity = 147/193 (76.17%), Postives = 168/193 (87.05%), Query Frame = 3
Query:   12 CLGKLRSSPWSELDGLQPETKIINEQLGKINVKGFLTINSQPAVNGERSDSSSVGWGGPGGYVYQKAYLEFFCSPEKLTALVDKSKALPFITFMAVNKEGNWKANVNQTDVNAVTWGVFPAKEIIQPTVVDPASFKVWKDEAFEIWSRSWASLYPEGDSSRKLLEEVQSSYYLVSLVDNDYINGDLFTVFADL 590
            C GKL SSPWSELDGLQPETKII++QL KIN KGFLTINSQPAVNGERSDS+SVGWGGPGGYVYQKAYLEFFCS EKL  L++KSKA P +T++AVNK+G   +N+    VNAVTWGVFP KEI+QPTVVD ASF VWKDEAFEIWS+ WA L+PEGDSSR++L++VQ SY+LVSLVDNDYINGDLF  F ++
Sbjct:  402 CQGKLTSSPWSELDGLQPETKIIDDQLVKINQKGFLTINSQPAVNGERSDSTSVGWGGPGGYVYQKAYLEFFCSKEKLDQLIEKSKAFPSLTYIAVNKDGESFSNIPTNAVNAVTWGVFPGKEIVQPTVVDSASFMVWKDEAFEIWSKGWACLFPEGDSSREILDKVQKSYFLVSLVDNDYINGDLFAAFKEI 594          
BLAST of EY756499 vs. ExPASy Swiss-Prot
Match: MTHR1_MAIZE (Methylenetetrahydrofolate reductase 1 OS=Zea mays PE=2 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 2.323e-81
Identity = 142/193 (73.58%), Postives = 163/193 (84.46%), Query Frame = 3
Query:    3 TRPCLGKLRSSPWSELDGLQPETKIINEQLGKINVKGFLTINSQPAVNGERSDSSSVGWGGPGGYVYQKAYLEFFCSPEKLTALVDKSKALPFITFMAVNKEGNWKANVNQTDVNAVTWGVFPAKEIIQPTVVDPASFKVWKDEAFEIWSRSWASLYPEGDSSRKLLEEVQSSYYLVSLVDNDYINGDLFTVF 581
            T  C GKL SSPWSELDGLQPETKII++QL  IN KGFLTINSQPAVNGE+SDS +VGWGGPGGYVYQKAYLEFFC+ EKL  L++K KA P +T++AVNK+G   +N++   VNAVTWGVFP KEIIQPTVVD ASF VWKDEAFEIW+R W  ++PEGDSSR+LLE+VQ +YYLVSLVDNDY+ GDLF  F
Sbjct:  399 TNFCQGKLTSSPWSELDGLQPETKIIDDQLVNINQKGFLTINSQPAVNGEKSDSPTVGWGGPGGYVYQKAYLEFFCAKEKLDQLIEKIKAFPSLTYIAVNKDGETFSNISPNAVNAVTWGVFPGKEIIQPTVVDHASFMVWKDEAFEIWTRGWGCMFPEGDSSRELLEKVQKTYYLVSLVDNDYVQGDLFAAF 591          
BLAST of EY756499 vs. ExPASy Swiss-Prot
Match: MTHR_MACFA (Methylenetetrahydrofolate reductase OS=Macaca fascicularis GN=MTHFR PE=2 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 1.472e-43
Identity = 86/179 (48.04%), Postives = 115/179 (64.25%), Query Frame = 3
Query:   21 KLRSSPWSELDGLQPETKIINEQLGKINVKGFLTINSQPAVNGERSDSSSVGWGGPGGYVYQKAYLEFFCSPEKLTALVDKSKALPF-ITFMAVNKEGNWKANVNQTDVNAVTWGVFPAKEIIQPTVVDPASFKVWKDEAFEIWSRSWASLYPEGDSSRKLLEEVQSSYYLVSLVDNDY 554
            K+   PW++ + L  ET ++ E+L ++N +G LTINSQP +NG+ S    VGWG  GGYV+QKAYLEFF S E   AL+   K     + +  VN +G    N  +   NAVTWG+FP +EIIQPTVVDP SF  WKDEAF +W   W  LY E   SR +++ +  +Y+LV+LVDND+
Sbjct:  449 KVTCLPWND-EPLAAETSLLKEELLRVNRQGILTINSQPNINGKPSSDPVVGWGPSGGYVFQKAYLEFFTSRETAEALLQVLKKYELRVNYHLVNVKGENITNAPELQPNAVTWGIFPGREIIQPTVVDPISFMFWKDEAFALWIEQWGKLYEEESPSRTIIQYIHDNYFLVNLVDNDF 626          
BLAST of EY756499 vs. ExPASy Swiss-Prot
Match: MTHR_HUMAN (Methylenetetrahydrofolate reductase OS=Homo sapiens GN=MTHFR PE=1 SV=3)

HSP 1 Score: 176.792 bits (447), Expect = 1.472e-43
Identity = 86/179 (48.04%), Postives = 115/179 (64.25%), Query Frame = 3
Query:   21 KLRSSPWSELDGLQPETKIINEQLGKINVKGFLTINSQPAVNGERSDSSSVGWGGPGGYVYQKAYLEFFCSPEKLTALVDKSKALPF-ITFMAVNKEGNWKANVNQTDVNAVTWGVFPAKEIIQPTVVDPASFKVWKDEAFEIWSRSWASLYPEGDSSRKLLEEVQSSYYLVSLVDNDY 554
            K+   PW++ + L  ET ++ E+L ++N +G LTINSQP +NG+ S    VGWG  GGYV+QKAYLEFF S E   AL+   K     + +  VN +G    N  +   NAVTWG+FP +EIIQPTVVDP SF  WKDEAF +W   W  LY E   SR +++ +  +Y+LV+LVDND+
Sbjct:  449 KVTCLPWND-EPLAAETSLLKEELLRVNRQGILTINSQPNINGKPSSDPIVGWGPSGGYVFQKAYLEFFTSRETAEALLQVLKKYELRVNYHLVNVKGENITNAPELQPNAVTWGIFPGREIIQPTVVDPVSFMFWKDEAFALWIERWGKLYEEESPSRTIIQYIHDNYFLVNLVDNDF 626          
BLAST of EY756499 vs. ExPASy Swiss-Prot
Match: MTHR_BOVIN (Methylenetetrahydrofolate reductase OS=Bos taurus GN=MTHFR PE=2 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 7.307e-43
Identity = 84/179 (46.93%), Postives = 116/179 (64.80%), Query Frame = 3
Query:   21 KLRSSPWSELDGLQPETKIINEQLGKINVKGFLTINSQPAVNGERSDSSSVGWGGPGGYVYQKAYLEFFCSPEKLTALVDKSKALPF-ITFMAVNKEGNWKANVNQTDVNAVTWGVFPAKEIIQPTVVDPASFKVWKDEAFEIWSRSWASLYPEGDSSRKLLEEVQSSYYLVSLVDNDY 554
            K+   PW++ + L  ET ++ E+L ++N +G LTINSQP +NG+ S    VGWG  GGYV+QKAYLEFF S E + AL+   K     + +  V+ +G    N  +   NAVTWG+FP +EIIQPTVVDP SF  WKDEAF +W   W  LY E   SR +++ +  +Y+LV+LVDN++
Sbjct:  448 KVTCLPWND-EPLAAETSLMKEELLRVNRRGILTINSQPNINGKPSSDPIVGWGPSGGYVFQKAYLEFFTSRETVEALLQVLKKYELRVNYHIVDVKGENITNAPELQPNAVTWGIFPGREIIQPTVVDPVSFMFWKDEAFALWIEQWGKLYEEESPSRMIIQYIHDNYFLVNLVDNEF 625          
BLAST of EY756499 vs. ExPASy Swiss-Prot
Match: MTHR1_SCHPO (Methylenetetrahydrofolate reductase 1 OS=Schizosaccharomyces pombe GN=met9 PE=1 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 2.777e-42
Identity = 90/193 (46.63%), Postives = 116/193 (60.10%), Query Frame = 3
Query:    6 RPCLGKLRSSPWSELDGLQPETKIINEQLGKINVKGFLTINSQPAVNGERSDSSSVGWGGPGGYVYQKAYLEFFCSPEKLTALVDKSKALPFITFMAVNKEGNWKANVNQTDVNAVTWGVFPAKEIIQPTVVDPASFKVWKDEAFEIWSRSWASLYPEGDSSRKLLEEVQSSYYLVSLVDNDYING-DLFTVF 581
            R C  K+ S PWS+L  +  E  +I +QL  +N   FLTINSQPA+NGE+S     GWG P GYV+QK Y+EFF  P  L  L +  K L  +++   NK G+   N      NAVTWGVFP +EIIQPT+V+  SF  WKDEA+ +    WA+ Y     SRKLL  +   ++L  +VDND+ NG  LF VF
Sbjct:  394 RYCEKKISSLPWSDLP-ISDEADLIRDQLLSMNRNAFLTINSQPALNGEKSSHPVFGWGPPNGYVFQKPYVEFFVHPSLLNELKETVKKLNSVSYFVTNKNGDLDTNSQYEIPNAVTWGVFPNREIIQPTIVESTSFLAWKDEAYSL-GMEWANAYSPDSISRKLLVSMMKEWFLCVIVDNDFQNGQSLFDVF 584          
BLAST of EY756499 vs. ExPASy Swiss-Prot
Match: MTHR_CAEEL (Probable methylenetetrahydrofolate reductase OS=Caenorhabditis elegans GN=C06A8.1 PE=1 SV=2)

HSP 1 Score: 172.17 bits (435), Expect = 3.626e-42
Identity = 86/183 (46.99%), Postives = 118/183 (64.48%), Query Frame = 3
Query:   21 KLRSSPWSELD-GLQPETKIINEQLGKINVKGFLTINSQPAVNGERSDSSSVGWGGPGGYVYQKAYLEFFCSPE---KLTALVDKSKALPFITFMAVNKEGNW-KANVNQTDVNAVTWGVFPAKEIIQPTVVDPASFKVWKDEAFEIWSRSWASLYPEGDSSRKLLEEVQSSYYLVSLVDNDY 554
            K+   PW+E + G+QPET +I+EQL   N  G LT+NSQP+VNG  S    VGWG PGGY YQKAYLE F + E   KL  ++++   +  + + A+NK+  + K N  +T   AVTWGVFP  EI QPTVVDP SF+ W+DEA+++W   W   YP+   S  +++ V   + LV+LVDND+
Sbjct:  463 KVTVLPWTEAETGVQPETSLISEQLVWCNENGILTVNSQPSVNGAPSTDPLVGWGKPGGYCYQKAYLECFMTAELSDKLIQIIEREFPVR-VNYHAINKDSTFDKTNSEETTPIAVTWGVFPGSEIAQPTVVDPLSFRAWRDEAYQMWMAQWGDFYPKESKSYGVIKAVHDEFRLVTLVDNDF 644          
BLAST of EY756499 vs. ExPASy Swiss-Prot
Match: MTHR_MOUSE (Methylenetetrahydrofolate reductase OS=Mus musculus GN=Mthfr PE=2 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 1.800e-41
Identity = 82/174 (47.13%), Postives = 112/174 (64.37%), Query Frame = 3
Query:   36 PWSELDGLQPETKIINEQLGKINVKGFLTINSQPAVNGERSDSSSVGWGGPGGYVYQKAYLEFFCSPEKLTALVDKSKALPF-ITFMAVNKEGNWKANVNQTDVNAVTWGVFPAKEIIQPTVVDPASFKVWKDEAFEIWSRSWASLYPEGDSSRKLLEEVQSSYYLVSLVDNDY 554
            PW++ + L  ET ++ E+L ++N  G LTINSQP +N + S    VGWG  GGYV+QKAYLEFF S E + AL+   K     + +  V+ +G    N  +   NAVTWG+FP +EIIQPTVVDP SF  WKDEAF +W   W  LY E   SR +++ +  +Y+LV+LVDN++
Sbjct:  453 PWND-EPLAAETSLMKEELLRVNRLGILTINSQPNINAKPSSDPVVGWGPSGGYVFQKAYLEFFTSRETVEALLQVLKTYELRVNYHIVDVKGENITNAPELQPNAVTWGIFPGREIIQPTVVDPISFMFWKDEAFALWIEQWGKLYEEESPSRMIIQYIHDNYFLVNLVDNEF 625          
The following BLAST results are available for this feature:
BLAST of EY756499 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
MTHR1_ARATH4.671e-9080.10Methylenetetrahydrofolate reductase 1 OS=Arabidops... [more]
MTHR2_ARATH1.962e-8880.31Methylenetetrahydrofolate reductase 2 OS=Arabidops... [more]
MTHR_ORYSJ1.719e-8476.17Probable methylenetetrahydrofolate reductase OS=Or... [more]
MTHR1_MAIZE2.323e-8173.58Methylenetetrahydrofolate reductase 1 OS=Zea mays ... [more]
MTHR_MACFA1.472e-4348.04Methylenetetrahydrofolate reductase OS=Macaca fasc... [more]
MTHR_HUMAN1.472e-4348.04Methylenetetrahydrofolate reductase OS=Homo sapien... [more]
MTHR_BOVIN7.307e-4346.93Methylenetetrahydrofolate reductase OS=Bos taurus ... [more]
MTHR1_SCHPO2.777e-4246.63Methylenetetrahydrofolate reductase 1 OS=Schizosac... [more]
MTHR_CAEEL3.626e-4246.99Probable methylenetetrahydrofolate reductase OS=Ca... [more]
MTHR_MOUSE1.800e-4147.13Methylenetetrahydrofolate reductase OS=Mus musculu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-009-C10-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756499 ID=EY756499|Name=EY756499|organism=Citrus sinensis|type=EST|length=894bp
CCACGCGTCCGTGCCTTGGGAAATTGAGAAGCAGTCCTTGGTCAGAGTTA
GACGGGCTTCAGCCAGAGACCAAAATCATAAATGAACAGCTTGGAAAGAT
CAATGTGAAAGGTTTCCTCACTATCAACAGCCAGCCGGCAGTCAATGGTG
AAAGATCCGATTCATCTTCTGTTGGTTGGGGTGGGCCAGGAGGATATGTT
TATCAGAAAGCATATCTAGAGTTTTTCTGCTCACCAGAGAAGTTGACTGC
ACTTGTTGACAAAAGCAAAGCTCTTCCATTCATAACCTTCATGGCTGTCA
ACAAAGAAGGGAACTGGAAAGCCAATGTTAATCAAACTGATGTGAATGCC
GTAACTTGGGGGGTCTTCCCAGCCAAGGAGATTATCCAACCGACTGTTGT
TGACCCTGCCAGCTTCAAGGTGTGGAAGGATGAGGCATTCGAAATTTGGT
CAAGATCATGGGCTTCATTGTACCCCGAGGGAGACTCATCAAGAAAATTG
CTCGAAGAGGTGCAGAGCAGCTATTATTTGGTCAGCTTGGTGGATAATGA
TTACATCAATGGGGATCTTTTTACTGTTTTTGCCGATCTCTAGGTTAAGC
TGCTGTACTCCATGGAATTACAACCTGATTTCATCAATGGTCATCTTGTA
CCCTCACTGAAGCCATTTGAAGTGTTGCCTTCTCTCAAGTTAATTTCAAT
TGAAATTTATCCAAAATTACAAGCTTACTGATTGTATTAATAAGATGATA
GGGATTTTGATACCTCCCTGATGCTCCATGCAAATTAAATNGGCAGCTTT
CATTTCTATGAATCGCTCCTAAATTATTTGTCATGGAAAAGTGCATCCTG
AAATTGTAGCGTTACCGAATATATTTAATCCAATAAGTGAGTCT
back to top