EY756471

Overview
NameEY756471
Unique NameEY756471
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length821
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig12327 contig Csv1_Contig12327:178..991. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756471 vs. ExPASy Swiss-Prot
Match: PAP8_ARATH (Probable plastid-lipid-associated protein 8, chloroplastic OS=Arabidopsis thaliana GN=PAP8 PE=2 SV=1)

HSP 1 Score: 268.085 bits (684), Expect = 4.257e-71
Identity = 129/186 (69.35%), Postives = 154/186 (82.80%), Query Frame = 2
Query:   11 SISSP--DLRTGPDDLVASILSKVNQSDGGVSLXXXXXXXXXXXXXXLQKYCVEAPVKCPLIFGEWDVVYCSVPTSPGGGYRSAFGRLFFKTKEMIQAVEAPDTVRNKVSFTALGFLDGEVSLKGKLNALDEKWIQVVFEPPELKVGGLEFRYGGQSEVKLQITYIDEKIRLGLGSRGSLFVFQRR 562
            S+S+P  +LRTGPDDL++++LSKV  SDGGV+L              LQKYCV+ PVK PLIFG+W+VVYCS PTSPGGGYRS  GRLFFKTKEMIQA++APD VRNKVS  A GFLDG+VSL GKL ALD +W+QV+FEPPE+KVG LEF+YG +SEVKL+ITY+DEK+RLGLGS+GSLFVF+RR
Sbjct:   53 SVSAPNVELRTGPDDLISTLLSKVANSDGGVTLSPEQHKEVAQVAGELQKYCVKEPVKNPLIFGDWEVVYCSRPTSPGGGYRSVIGRLFFKTKEMIQAIDAPDIVRNKVSINAFGFLDGDVSLTGKLKALDSEWVQVIFEPPEIKVGSLEFKYGFESEVKLRITYVDEKLRLGLGSKGSLFVFRRR 238          
The following BLAST results are available for this feature:
BLAST of EY756471 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
PAP8_ARATH4.257e-7169.35Probable plastid-lipid-associated protein 8, chlor... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-009-A02-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756471 ID=EY756471|Name=EY756471|organism=Citrus sinensis|type=EST|length=821bp
CAGGGCTGTTTCCATCTCCAGCCCAGATCTGCGAACCGGTCCCGACGATT
TGGTTGCTTCTATCCTCTCCAAGGTGAACCAATCGGATGGAGGAGTTTCA
CTAGCCAAAGAAGAACACAAAGAGGTCGCTGAAGTTGCTCAAGAGTTGCA
AAAATATTGTGTTGAAGCACCAGTAAAATGCCCTCTAATCTTTGGAGAAT
GGGATGTCGTGTACTGTTCAGTGCCAACTTCACCTGGGGGTGGCTACAGA
AGTGCATTTGGCCGTCTTTTCTTCAAAACAAAGGAAATGATTCAGGCTGT
TGAAGCTCCTGACACTGTTAGAAACAAGGTTTCCTTCACCGCTCTGGGTT
TTCTTGACGGAGAGGTCTCTTTGAAAGGAAAGCTTAATGCTCTGGATGAG
AAATGGATTCAAGTTGTATTTGAACCACCTGAACTGAAAGTTGGAGGATT
GGAGTTCCGATATGGCGGTCAGAGTGAGGTTAAGTTGCAGATTACATACA
TAGATGAAAAGATCAGGCTGGGGTTAGGATCGAGAGGTTCACTATTTGTT
TTCCAGAGACGCACACAAGCAGCATAGCTGGACAGAGTTAAAGTTTGTGC
TTGGTGTCTGTAAATCCTGAATGCTTNNCTTGTATGCCAAGCTATGCCCG
TGAATAGCAAATTAGGCAGAAACTGATGCCTCAGCGCCATACCGTATCTA
TCGTACACTGTAATCACAACTCAACTGGTGGATGATANAACATGCAATCC
TGAATTAATGCCTATTCTCGCCGAGCAGCAGAAAAGCATTTATCAAAAAA
AAAAAAAAAAAAAAAAAAAAA
back to top