EY756468

Overview
NameEY756468
Unique NameEY756468
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length885
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY756468 vs. ExPASy Swiss-Prot
Match: YTHD1_MOUSE (YTH domain family protein 1 OS=Mus musculus GN=Ythdf1 PE=2 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 5.384e-22
Identity = 52/86 (60.47%), Postives = 60/86 (69.77%), Query Frame = 1
Query:   13 QDKWNGYFPVKWHIIKDVPNPQLRHIILENNDKKPVTNSRDTQEVKFPQGIEILNIFKNYPSKTSILDDFDFYESRQKVMQEKKVR 270
            QDKW G F VKW  +KDVPN QLRHI LENND KPVTNSRDTQEV   +  ++L I  +Y   TSI DDF  YE RQ+  +E+ VR
Sbjct:  467 QDKWKGKFDVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQE--EEEVVR 550          
BLAST of EY756468 vs. ExPASy Swiss-Prot
Match: YTHD1_HUMAN (YTH domain family protein 1 OS=Homo sapiens GN=YTHDF1 PE=1 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 2.046e-21
Identity = 51/86 (59.30%), Postives = 60/86 (69.77%), Query Frame = 1
Query:   13 QDKWNGYFPVKWHIIKDVPNPQLRHIILENNDKKPVTNSRDTQEVKFPQGIEILNIFKNYPSKTSILDDFDFYESRQKVMQEKKVR 270
            QDKW G F V+W  +KDVPN QLRHI LENND KPVTNSRDTQEV   +  ++L I  +Y   TSI DDF  YE RQ+  +E+ VR
Sbjct:  467 QDKWKGKFDVQWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIISSYKHTTSIFDDFAHYEKRQE--EEEVVR 550          
BLAST of EY756468 vs. ExPASy Swiss-Prot
Match: YTHD3_PONAB (YTH domain family protein 3 OS=Pongo abelii GN=YTHDF3 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 3.490e-21
Identity = 52/94 (55.32%), Postives = 62/94 (65.96%), Query Frame = 1
Query:   13 QDKWNGYFPVKWHIIKDVPNPQLRHIILENNDKKPVTNSRDTQEVKFPQGIEILNIFKNYPSKTSILDDFDFYESRQKVMQEKKVRLSVSRLDQ 294
            QDKW G F VKW  +KDVPN QLRHI LENND KPVTNSRDTQEV   +  ++L I   +   TSI DDF  YE RQ+  +E+ +R   +R  Q
Sbjct:  494 QDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIATFKHTTSIFDDFAHYEKRQE--EEEAMRRERNRNKQ 585          
BLAST of EY756468 vs. ExPASy Swiss-Prot
Match: YTHD3_MOUSE (YTH domain family protein 3 OS=Mus musculus GN=Ythdf3 PE=1 SV=2)

HSP 1 Score: 102.449 bits (254), Expect = 3.490e-21
Identity = 52/94 (55.32%), Postives = 62/94 (65.96%), Query Frame = 1
Query:   13 QDKWNGYFPVKWHIIKDVPNPQLRHIILENNDKKPVTNSRDTQEVKFPQGIEILNIFKNYPSKTSILDDFDFYESRQKVMQEKKVRLSVSRLDQ 294
            QDKW G F VKW  +KDVPN QLRHI LENND KPVTNSRDTQEV   +  ++L I   +   TSI DDF  YE RQ+  +E+ +R   +R  Q
Sbjct:  494 QDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIATFKHTTSIFDDFAHYEKRQE--EEEAMRRERNRNKQ 585          
BLAST of EY756468 vs. ExPASy Swiss-Prot
Match: YTHD3_HUMAN (YTH domain family protein 3 OS=Homo sapiens GN=YTHDF3 PE=1 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 3.490e-21
Identity = 52/94 (55.32%), Postives = 62/94 (65.96%), Query Frame = 1
Query:   13 QDKWNGYFPVKWHIIKDVPNPQLRHIILENNDKKPVTNSRDTQEVKFPQGIEILNIFKNYPSKTSILDDFDFYESRQKVMQEKKVRLSVSRLDQ 294
            QDKW G F VKW  +KDVPN QLRHI LENND KPVTNSRDTQEV   +  ++L I   +   TSI DDF  YE RQ+  +E+ +R   +R  Q
Sbjct:  494 QDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIIATFKHTTSIFDDFAHYEKRQE--EEEAMRRERNRNKQ 585          
BLAST of EY756468 vs. ExPASy Swiss-Prot
Match: YTHD2_MACFA (YTH domain family protein 2 OS=Macaca fascicularis GN=YTHDF2 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 3.490e-21
Identity = 48/84 (57.14%), Postives = 57/84 (67.86%), Query Frame = 1
Query:   13 QDKWNGYFPVKWHIIKDVPNPQLRHIILENNDKKPVTNSRDTQEVKFPQGIEILNIFKNYPSKTSILDDFDFYESRQKVMQEKK 264
            QDKW G F V+W  +KDVPN QLRHI LENN+ KPVTNSRDTQEV   +  ++L I  +Y   TSI DDF  YE RQ+  +  K
Sbjct:  488 QDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEEESVK 571          
BLAST of EY756468 vs. ExPASy Swiss-Prot
Match: YTHD2_HUMAN (YTH domain family protein 2 OS=Homo sapiens GN=YTHDF2 PE=1 SV=2)

HSP 1 Score: 102.449 bits (254), Expect = 3.490e-21
Identity = 48/84 (57.14%), Postives = 57/84 (67.86%), Query Frame = 1
Query:   13 QDKWNGYFPVKWHIIKDVPNPQLRHIILENNDKKPVTNSRDTQEVKFPQGIEILNIFKNYPSKTSILDDFDFYESRQKVMQEKK 264
            QDKW G F V+W  +KDVPN QLRHI LENN+ KPVTNSRDTQEV   +  ++L I  +Y   TSI DDF  YE RQ+  +  K
Sbjct:  488 QDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEEESVK 571          
BLAST of EY756468 vs. ExPASy Swiss-Prot
Match: YTHD2_BOVIN (YTH domain family protein 2 OS=Bos taurus GN=YTHDF2 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 3.490e-21
Identity = 48/84 (57.14%), Postives = 57/84 (67.86%), Query Frame = 1
Query:   13 QDKWNGYFPVKWHIIKDVPNPQLRHIILENNDKKPVTNSRDTQEVKFPQGIEILNIFKNYPSKTSILDDFDFYESRQKVMQEKK 264
            QDKW G F V+W  +KDVPN QLRHI LENN+ KPVTNSRDTQEV   +  ++L I  +Y   TSI DDF  YE RQ+  +  K
Sbjct:  489 QDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEEESVK 572          
The following BLAST results are available for this feature:
BLAST of EY756468 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
YTHD1_MOUSE5.384e-2260.47YTH domain family protein 1 OS=Mus musculus GN=Yth... [more]
YTHD1_HUMAN2.046e-2159.30YTH domain family protein 1 OS=Homo sapiens GN=YTH... [more]
YTHD3_PONAB3.490e-2155.32YTH domain family protein 3 OS=Pongo abelii GN=YTH... [more]
YTHD3_MOUSE3.490e-2155.32YTH domain family protein 3 OS=Mus musculus GN=Yth... [more]
YTHD3_HUMAN3.490e-2155.32YTH domain family protein 3 OS=Homo sapiens GN=YTH... [more]
YTHD2_MACFA3.490e-2157.14YTH domain family protein 2 OS=Macaca fascicularis... [more]
YTHD2_HUMAN3.490e-2157.14YTH domain family protein 2 OS=Homo sapiens GN=YTH... [more]
YTHD2_BOVIN3.490e-2157.14YTH domain family protein 2 OS=Bos taurus GN=YTHDF... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-008-H11-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756468 ID=EY756468|Name=EY756468|organism=Citrus sinensis|type=EST|length=885bp
CCACGCGTCCGACAGGATAAGTGGAATGGTTATTTCCCTGTCAAGTGGCA
CATTATAAAAGATGTTCCAAACCCGCAGTTACGACATATAATACTTGAAA
ATAATGACAAGAAGCCAGTAACCAATAGCAGAGACACACAGGAGGTGAAA
TTTCCTCAGGGTATTGAAATTTTGAACATATTTAAGAATTATCCTTCGAA
GACGTCCATATTGGATGATTTTGATTTTTATGAAAGCCGTCAAAAGGTGA
TGCAAGAAAAGAAAGTAAGACTATCTGTGTCCCGTCTTGATCAGATTCAG
ATACAGTCGAAAGCAGATGACTTAACCTCCAGCTTTCAGTCAATAGGTTT
ATCTGCTGTAGAAAATGTTGAGGGCTGCAAGGAATAAGGGAAGGAATAAA
GGAGGGCAACGGCTTGACGGATTGATTAATGAAAGCCAATGGATGCACTG
GGAGACTTCTTCCCCATCACTGCTGATGGCAGCACCACCTGGACCTTGAT
GCAAAATAGAAGTTTGAGAAATGAAATAAGGTTTTTTAAGGAAACGCCAA
GTTTTTGGCTAGTTTTGGTGGTACTTTGCCAGGCAAGAATGATTCCCTCA
CACAGAAAATGGAATGATCGTTTGGGTGACCTTTGGATAAGACAGTGGTC
TTTTGTTTGCCATATAGAAAAAGCATGATTCCNAACATGAATTGATGATC
TTAATGCAAGTTTCTGCTCATTTTTTACTTTTCATAGCGGGGGAATCCAT
TTGTATTCCCTCCACTCACATTTCTTTANGTGAATCATTTGTACTCCACA
GATTTTCTTTATGTTTTGCGGTGTGTGTGCTGNTATGCATACCNGCGACT
GTGGTGGCATCTGCTTTTAATGTCCGTTCAGTAAA
back to top