EY756466

Overview
NameEY756466
Unique NameEY756466
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length852
Libraries
Library NameType
Sweet orange leaf, field plant Bcdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13330 contig Csv1_Contig13330:1..853. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY756466 vs. ExPASy Swiss-Prot
Match: PTBP2_ARATH (Polypyrimidine tract-binding protein homolog 2 OS=Arabidopsis thaliana GN=At5g53180 PE=2 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 3.248e-29
Identity = 67/93 (72.04%), Postives = 74/93 (79.57%), Query Frame = 3
Query:   12 NGGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHISYSRHTDLSIKVNNDRSRDYTLPSTPMVNSQPSILGQQPV--PMVGATANQYNGA 284
            NGG+QALIQY DVQTAVVAKEALEGHCIYDGGFCKLHI+YSRHTDLSIKVNNDRSRDYT+P+ P+       + QQPV  P  G    QY+ A
Sbjct:  281 NGGVQALIQYSDVQTAVVAKEALEGHCIYDGGFCKLHITYSRHTDLSIKVNNDRSRDYTMPNPPVP------MPQQPVQNPYAG-NPQQYHAA 366          
BLAST of EY756466 vs. ExPASy Swiss-Prot
Match: PTBP1_ARATH (Polypyrimidine tract-binding protein homolog 1 OS=Arabidopsis thaliana GN=PTB PE=2 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 1.012e-22
Identity = 49/79 (62.03%), Postives = 62/79 (78.48%), Query Frame = 3
Query:   12 NGGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHISYSRHTDLSIKVNNDRSRDYTLPSTPMVNSQ--PSILGQQP 242
            NG  QALIQY D+ TA +AKEALEGHCIYDGG+CKL +SYSRHTDL++K  +D+SRDYTLP   ++ +Q  P++ G  P
Sbjct:  280 NGSTQALIQYSDIPTAAMAKEALEGHCIYDGGYCKLRLSYSRHTDLNVKAFSDKSRDYTLPDLSLLVAQKGPAVSGSAP 358          
BLAST of EY756466 vs. ExPASy Swiss-Prot
Match: PTBP1_PIG (Polypyrimidine tract-binding protein 1 OS=Sus scrofa GN=PTBP1 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 5.210e-11
Identity = 43/97 (44.33%), Postives = 57/97 (58.76%), Query Frame = 3
Query:   12 NGGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHISYSRHTDLSIKVNNDRSRDYTLPSTPMVNSQPSILGQQPVPMVGA----TANQYNGAQF 290
            N   QAL+QY D  +A  AK +L+G  IY+   C L I +S+ T L++K NND+SRDYT P  P  ++QPS L Q      GA    +A+ Y GA F
Sbjct:  219 NNQFQALLQYADPVSAQHAKLSLDGQNIYNA-CCTLRIDFSKLTSLNVKYNNDKSRDYTRPDLPSGDNQPS-LDQTMAAAFGAPGIMSASPYAGAGF 313          
BLAST of EY756466 vs. ExPASy Swiss-Prot
Match: PTBP1_RAT (Polypyrimidine tract-binding protein 1 OS=Rattus norvegicus GN=Ptbp1 PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 6.805e-11
Identity = 43/95 (45.26%), Postives = 56/95 (58.95%), Query Frame = 3
Query:   12 NGGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHISYSRHTDLSIKVNNDRSRDYTLPSTPMVNSQPSILGQQPVPMVGA----TANQYNGA 284
            N   QAL+QY D  +A  AK +L+G  IY+   C L I +S+ T L++K NND+SRDYT P  P  +SQPS L Q      GA    +A+ Y GA
Sbjct:  218 NNQFQALLQYADPVSAQHAKLSLDGQNIYNA-CCTLRIDFSKLTSLNVKYNNDKSRDYTRPDLPSGDSQPS-LDQTMAAAFGAPGIMSASPYAGA 310          
BLAST of EY756466 vs. ExPASy Swiss-Prot
Match: PTBP1_MOUSE (Polypyrimidine tract-binding protein 1 OS=Mus musculus GN=Ptbp1 PE=1 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 8.887e-11
Identity = 40/91 (43.96%), Postives = 53/91 (58.24%), Query Frame = 3
Query:   12 NGGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHISYSRHTDLSIKVNNDRSRDYTLPSTPMVNSQPSILGQQPVPMVGATANQYNGA 284
            N   QAL+QY D  +A  AK +L+G  IY+   C L I +S+ T L++K NND+SRDYT P  P  +SQPS L Q      G +    +GA
Sbjct:  218 NNQFQALLQYADPVSAQHAKLSLDGQNIYNA-CCTLRIDFSKLTSLNVKYNNDKSRDYTRPDLPSGDSQPS-LDQTMAAAFGLSVPNVHGA 306          
BLAST of EY756466 vs. ExPASy Swiss-Prot
Match: PTBP1_HUMAN (Polypyrimidine tract-binding protein 1 OS=Homo sapiens GN=PTBP1 PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 8.887e-11
Identity = 40/91 (43.96%), Postives = 53/91 (58.24%), Query Frame = 3
Query:   12 NGGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHISYSRHTDLSIKVNNDRSRDYTLPSTPMVNSQPSILGQQPVPMVGATANQYNGA 284
            N   QAL+QY D  +A  AK +L+G  IY+   C L I +S+ T L++K NND+SRDYT P  P  +SQPS L Q      G +    +GA
Sbjct:  219 NNQFQALLQYADPVSAQHAKLSLDGQNIYNA-CCTLRIDFSKLTSLNVKYNNDKSRDYTRPDLPSGDSQPS-LDQTMAAAFGLSVPNVHGA 307          
BLAST of EY756466 vs. ExPASy Swiss-Prot
Match: PTBP1_BOVIN (Polypyrimidine tract-binding protein 1 OS=Bos taurus GN=PTBP1 PE=2 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 8.887e-11
Identity = 40/91 (43.96%), Postives = 53/91 (58.24%), Query Frame = 3
Query:   12 NGGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHISYSRHTDLSIKVNNDRSRDYTLPSTPMVNSQPSILGQQPVPMVGATANQYNGA 284
            N   QAL+QY D  +A  AK +L+G  IY+   C L I +S+ T L++K NND+SRDYT P  P  +SQPS L Q      G +    +GA
Sbjct:  219 NNQFQALLQYADPVSAQHAKLSLDGQNIYNA-CCTLRIDFSKLTSLNVKYNNDKSRDYTRPDLPSGDSQPS-LDQTMAAAFGLSVPNVHGA 307          
The following BLAST results are available for this feature:
BLAST of EY756466 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
PTBP2_ARATH3.248e-2972.04Polypyrimidine tract-binding protein homolog 2 OS=... [more]
PTBP1_ARATH1.012e-2262.03Polypyrimidine tract-binding protein homolog 1 OS=... [more]
PTBP1_PIG5.210e-1144.33Polypyrimidine tract-binding protein 1 OS=Sus scro... [more]
PTBP1_RAT6.805e-1145.26Polypyrimidine tract-binding protein 1 OS=Rattus n... [more]
PTBP1_MOUSE8.887e-1143.96Polypyrimidine tract-binding protein 1 OS=Mus musc... [more]
PTBP1_HUMAN8.887e-1143.96Polypyrimidine tract-binding protein 1 OS=Homo sap... [more]
PTBP1_BOVIN8.887e-1143.96Polypyrimidine tract-binding protein 1 OS=Bos taur... [more]
back to top
Properties
Property NameValue
Genbank descriptionCS13-C1-001-008-H09-CT.F Sweet orange leaf, field plant B Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY756466 ID=EY756466|Name=EY756466|organism=Citrus sinensis|type=EST|length=852bp
CCACGCGTCCGAATGGTGGACTTCAGGCTTTGATTCAATACCCTGATGTT
CAGACAGCTGTTGTTGCGAAGGAAGCTTTGGAAGGACACTGTATCTATGA
TGGGGGGTTTTGCAAGCTTCACATATCATACTCTCGCCATACTGATCTTA
GTATTAAGGTCAATAATGATAGGAGCAGAGATTATACGCTCCCTAGCACT
CCCATGGTGAACTCGCAACCTTCAATTCTTGGACAACAGCCGGTTCCAAT
GGTTGGTGCCACTGCTAATCAATACAATGGGGCGCAGTTTGCTCCTCCGC
CTCCGGAGCAGCCTATGATGCATCAGCCTACTGCAGCCGGATGGGGAGCT
GTTCCACCAGCTTCACAATCCATGCCCATGATGGGCAATCATCCCTACAT
GCCTCCAGGTTCTATGCCTATGGGCCCCGGAATGATGCAGATGCACATGC
CAGGCCAGAGTGGCATGCAGCATCATCACGGGGCAATGCCCCCACCGAGA
CCTGATCACATGCAATAGCATATCTTCAGAAATGGTTCTGCTAGTTTTGT
TTAATGGTGGGAAGTGAAGCATATTCAAAAGTGGATTTCCATTGGGATGA
AGCGACCATTGATCAAGCAAAGGCAACTTGTGAAGACCTCACAATTCTGA
AGCGTTTCTGTTGAGATGAAATTGTCACATCTTTTTCCTTTTTTCTTTTT
TGTTTGGGGTTTTTAATTTTCACCCTGCAATGCAATTCTGAAGGTGAAGT
TTATGTAAGCGGTGGGCTTGAATACCTGGTGGCGGCTGCCCCACACCGNT
ATGAACTGCGGATTCTTTCTTATGTTAATGTGAAATACTTTTGANGANNN
NN
back to top